KEGG   Bacillus subtilis subsp. subtilis 168: BSU30190
Entry
BSU30190          CDS       T00010                                 

Symbol
bioI
Name
(RefSeq) biotin biosynthesis cytochrome P450
  KO
K16593  pimeloyl-[acyl-carrier protein] synthase [EC:1.14.14.46]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00780  Biotin metabolism
bsu01100  Metabolic pathways
bsu01240  Biosynthesis of cofactors
Module
bsu_M00573  Biotin biosynthesis, BioI pathway, long-chain-acyl-ACP => pimeloyl-ACP => biotin
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BSU30190 (bioI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bsu00199]
    BSU30190 (bioI)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.46  pimeloyl-[acyl-carrier protein] synthase
     BSU30190 (bioI)
Cytochrome P450 [BR:bsu00199]
 Cytochrome P450, bacteria type
  CYP107 family
   BSU30190 (bioI)
SSDB
Motif
Pfam: p450 Cas_Cas5d
Other DBs
NCBI-GeneID: 935928
NCBI-ProteinID: NP_390897
Pasteur: BG11528
BSORF: BG11528
UniProt: P53554 A0A6M4JNY5
Structure
PDB: 
3EJB 3EJD 3EJE

Position
complement(3089226..3090413)
AA seq 395 aa
MTIASSTASSEFLKNPYSFYDTLRAVHPIYKGSFLKYPGWYVTGYEETAAILKDARFKVR
TPLPESSTKYQDLSHVQNQMMLFQNQPDHRRLRTLASGAFTPRTTESYQPYIIETVHHLL
DQVQGKKKMEVISDFAFPLASFVIANIIGVPEEDREQLKEWAASLIQTIDFTRSRKALTE
GNIMAVQAMAYFKELIQKRKRHPQQDMISMLLKGREKDKLTEEEAASTCILLAIAGHETT
VNLISNSVLCLLQHPEQLLKLRENPDLIGTAVEECLRYESPTQMTARVASEDIDICGVTI
RQGEQVYLLLGAANRDPSIFTNPDVFDITRSPNPHLSFGHGHHVCLGSSLARLEAQIAIN
TLLQRMPSLNLADFEWRYRPLFGFRALEELPVTFE
NT seq 1188 nt   +upstreamnt  +downstreamnt
gtgacaattgcatcgtcaactgcatcttctgagtttttgaaaaacccatattctttttac
gacacattgcgagctgttcatcctatctataaagggagtttcttaaaatacccgggctgg
tatgtcacaggatatgaagaaacggctgctattttgaaagatgcgagattcaaagtccgc
accccgctgcctgagagctcaaccaaatatcaggacctttcacatgtgcaaaatcaaatg
atgctgtttcagaaccagcctgatcatagacgattgcggacgcttgccagcggagcgttt
acgccgagaacgacagagagttatcagccgtatatcattgaaactgtccatcatttgctt
gatcaagtgcaaggtaaaaaaaagatggaggtcatttcggactttgcttttcctttagca
agttttgtcatagctaacattataggtgtaccggaggaagatagggagcaattaaaggag
tgggctgcgagtctcattcaaacgattgattttacccgctcaagaaaggcattaacagag
ggcaatattatggctgtgcaggctatggcatatttcaaagagctgattcaaaagagaaaa
cgccaccctcaacaggatatgatcagcatgctcttgaaggggagagaaaaggataagctg
acggaagaggaggcggcatctacgtgcatattgctggcgatcgccggacatgagacaacg
gtcaatctcatcagcaattcagtcctttgtctgctgcagcatccagaacagcttttgaaa
ctgagagaaaatccagatcttattggtaccgcagtcgaggaatgtttacgctatgaaagc
cccacgcaaatgacagccagagttgcgtcagaggatattgacatctgcggggtgacgatc
cgtcaaggagaacaagtctatcttttgttaggagcggctaatcgagaccctagcatattc
acgaaccccgatgtcttcgatattacgagaagtcctaatccgcatctttcattcgggcat
ggccatcatgtttgcttagggtcctcgctggcacgattagaagcgcaaattgcgattaac
actcttctgcagcgaatgcccagccttaatcttgcggattttgaatggcggtatcggccg
ctttttggatttcgggcgcttgaggagctgccggtgacttttgaataa

DBGET integrated database retrieval system