KEGG   Bacillus subtilis subsp. subtilis 168: BSU30200
Entry
BSU30200          CDS       T00010                                 

Symbol
bioB
Name
(RefSeq) biotin synthase
  KO
K01012  biotin synthase [EC:2.8.1.6]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00780  Biotin metabolism
bsu01100  Metabolic pathways
bsu01240  Biosynthesis of cofactors
Module
bsu_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
bsu_M00573  Biotin biosynthesis, BioI pathway, long-chain-acyl-ACP => pimeloyl-ACP => biotin
bsu_M00577  Biotin biosynthesis, BioW pathway, pimelate => pimeloyl-CoA => biotin
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BSU30200 (bioB)
Enzymes [BR:bsu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.6  biotin synthase
     BSU30200 (bioB)
SSDB
Motif
Pfam: Radical_SAM BATS His_biosynth
Other DBs
NCBI-GeneID: 938180
NCBI-ProteinID: NP_390898
Pasteur: BG11525
BSORF: BG11525
UniProt: P53557 A0A6M3ZFW1
Position
complement(3090482..3091489)
AA seq 335 aa
MNQWMELADRVLAGAEVTDEEALSILHCPDEDILLLMHGAFHIRKHFYGKKVKLNMIMNA
KSGLCPENCGYCSQSAISKAPIESYRMVNKETLLEGAKRAHDLNIGTYCIVASGRGPSNR
EVDQVVDAVQEIKETYGLKICACLGLLKPEQAKRLKDAGVDRYNHNLNTSQRNHSNITTS
HTYDDRVNTVEIAKESGLSPCSGAIIGMKETKQDVIDIAKSLKALDADSIPVNFLHAIDG
TPLEGVNELNPLYCLKVLALFRFINPSKEIRISGGREVNLRTLQPLGLYAANSIFVGDYL
TTAGQEETEDHKMLSDLGFEVESVEEMKASLSAKS
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgaatcaatggatggaactcgcagaccgggtgctggctggagcagaagtgactgacgaa
gaggcgctttcaatattacattgtcctgatgaagatattttgctattaatgcacggggct
tttcacatcagaaaacacttttacggaaaaaaagtaaagctcaatatgattatgaatgcg
aaatccgggctctgcccggaaaactgcggctattgttcacagtctgcgatttcgaaagcg
ccgattgagtcttaccggatggtgaataaggaaacgctgcttgaaggcgcgaagcgggcg
cacgatctgaatatcggcacatattgtatcgtggcaagcggcagaggtccgtctaacaga
gaagtggatcaggtcgtagatgcggttcaggaaattaaagagacgtatggactgaagatt
tgtgcatgtcttggactgttgaagccagagcaggcgaagcggctcaaagatgcaggagta
gaccgctataatcataatttgaatacgtcacagagaaaccattcaaacatcacaacctca
catacatacgatgacagagtcaatacggttgaaatcgcaaaagaatcggggctgtctccg
tgttcaggcgccattatcgggatgaaggagacgaaacaggatgtcattgacatcgccaaa
agcttgaaggctcttgacgcggattccattcctgtgaattttttgcatgcaattgatggc
acgccgttagaaggcgtcaacgaattaaacccgctgtattgtttaaaagtgctggcgctg
ttccgttttatcaatccatcaaaagaaattcgcatttccggaggaagagaggtcaatctc
cgcacattgcagccattagggctttacgccgcaaactccatttttgtcggagactactta
acaactgccgggcaagaggagacggaggatcataaaatgctgagtgatttaggctttgaa
gttgaatcagtcgaagaaatgaaggctagtttaagtgcgaaaagctga

DBGET integrated database retrieval system