KEGG   Bacillus subtilis subsp. subtilis 168: BSU30210
Entry
BSU30210          CDS       T00010                                 

Symbol
bioD
Name
(RefSeq) ATP-dependent dethiobiotin synthetase BioD
  KO
K01935  dethiobiotin synthetase [EC:6.3.3.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00780  Biotin metabolism
bsu01100  Metabolic pathways
bsu01240  Biosynthesis of cofactors
Module
bsu_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
bsu_M00573  Biotin biosynthesis, BioI pathway, long-chain-acyl-ACP => pimeloyl-ACP => biotin
bsu_M00577  Biotin biosynthesis, BioW pathway, pimelate => pimeloyl-CoA => biotin
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BSU30210 (bioD)
Enzymes [BR:bsu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.3  dethiobiotin synthase
     BSU30210 (bioD)
SSDB
Motif
Pfam: AAA_26 CbiA Fer4_NifH
Other DBs
NCBI-GeneID: 937264
NCBI-ProteinID: NP_390899
Pasteur: BG11526
BSORF: BG11526
UniProt: P53558 A0A6M4JKL5
Position
complement(3091492..3092187)
AA seq 231 aa
MRGFFVTGTDTEVGKTVISSGLAALLKDNNRHVGVYKPFLSGISRHHPDSDTSLLKDMSQ
TSLSHEDITPFAFKAPLAPYVAGKLEGKTVTMEEVLSHWGRIREKHECFIVEGAGGISVP
LGEDYLVSHVIKALQLPMIIVARPRLGTINHTFLTVKYAESMGLPIAGIIINGISDSPDE
DEKTNPEMIERLCGVPILGVTPKLANVTKETVLHMVKDHINLSLLMNQVGV
NT seq 696 nt   +upstreamnt  +downstreamnt
ttgaggggtttttttgtgacgggaactgatacagaagtagggaaaacggttatatccagc
ggtcttgctgccttattgaaagacaataatagacatgtcggggtgtataaaccattttta
agcgggatatcgcgccatcatccagatagtgatacaagtttgctgaaagatatgtcgcag
accagtctttctcatgaagacattacgccttttgccttcaaggcgccgcttgcaccatac
gttgcagggaaacttgagggaaagactgtcaccatggaagaggttttaagccattggggg
cggattagagaaaaacatgaatgcttcatcgtagaaggtgcaggcggtatttctgtgcca
ttgggagaggactatttggtcagtcatgtcataaaagcgttgcagcttcccatgattatt
gtggcgcgtcctcgccttggaaccattaatcatacctttttaactgtcaaatatgcagaa
agcatggggcttccaatcgccggaattatcatcaatggaatcagtgactctcctgatgaa
gatgaaaaaaccaatcctgagatgattgagcgcttatgcggtgtgccgattttaggggtt
acgccaaagcttgccaacgtgacgaaagaaacggttctacatatggtaaaagaccatatc
aatctatcattactgatgaatcaagtgggggtatga

DBGET integrated database retrieval system