KEGG   Bacillus subtilis subsp. subtilis 168: BSU30220Help
Entry
BSU30220          CDS       T00010                                 

Gene name
bioF
Definition
(RefSeq) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00780  Biotin metabolism
bsu01100  Metabolic pathways
Module
bsu_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
bsu_M00573  Biotin biosynthesis, BioI pathway, long-chain-acyl-ACP => pimeloyl-ACP => biotin
bsu_M00577  Biotin biosynthesis, BioW pathway, pimelate => pimeloyl-CoA => biotin
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BSU30220 (bioF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bsu01007]
    BSU30220 (bioF)
Enzymes [BR:bsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     BSU30220 (bioF)
Amino acid related enzymes [BR:bsu01007]
 Aminotransferase (transaminase)
  Class II
   BSU30220 (bioF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP Aminotran_5 Beta_elim_lyase DegT_DnrJ_EryC1 OKR_DC_1
Motif
Other DBs
NCBI-GeneID: 937268
NCBI-ProteinID: NP_390900
Pasteur: BG11527
BSORF: BG11527
UniProt: P53556
Position
complement(3092184..3093353)
Genome map
AA seq 389 aa AA seqDB search
MKIDSWLNERLDRMKEAGVHRNLRSMDGAPVPERNIDGENQTVWSSNNYLGLASDRRLID
AAQTALQQFGTGSSGSRLTTGNSVWHEKLEKKIASFKLTEAALLFSSGYLANVGVLSSLP
EKEDVILSDQLNHASMIDGCRLSKADTVVYRHIDMNDLENKLNETQRYQRRFIVTDGVFS
MDGTIAPLDQIISLAKRYHAFVVVDDAHATGVLGDSGQGTSEYFGVCPDIVIGTLSKAVG
AEGGFAAGSAVFIDFLLNHARTFIFQTAIPPASCAAAHEAFNIIEASREKRQLLFSYISM
IRTSLKNMGYVVKGDHTPIIPVVIGDAHKTVLFAEKLQGKGIYAPAIRPPTVAPGESRIR
ITITSDHSMGDIDHLLQTFHSIGKELHII
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
ttgaagattgattcctggttaaacgagcggttagacagaatgaaagaagccggcgtacat
cgtaacctgcggtcaatggatggagcgccggttccagagaggaatattgatggcgaaaat
caaacggtctggtcctcaaacaattatttagggctcgcaagcgatagacgtttgatcgat
gcagcccaaacagcattgcagcaatttgggacaggaagcagcggttcacgtttaacgaca
ggcaattcggtctggcatgaaaagctagaaaagaagattgccagctttaaactgacagaa
gcggccctgctgttttcgagcggttacttggccaatgtcggtgtcctttcatccttgcca
gaaaaggaagatgtcattttaagtgaccagctcaatcatgcaagtatgatcgacggctgc
cgactttctaaggctgatacagttgtttatcggcatattgatatgaatgatcttgaaaac
aagctgaatgaaacacagcgttatcagcgccgttttatcgtaacagacggagtattcagc
atggatggcacaatcgcccctcttgatcagatcatctcacttgcgaaacgctatcatgcc
ttcgtggtcgttgatgatgcccacgcaacaggagttttgggcgattcgggacaaggaacg
agtgaatactttggtgtttgtcccgacattgttatcggcaccttaagcaaagctgttggc
gcggaaggaggttttgcggcaggatcagcggtcttcatcgactttttgctgaaccatgcc
agaacatttatctttcaaaccgctattccgccagccagctgtgcggctgctcacgaggct
ttcaacatcattgaagccagcagggaaaaacgacagcttttattttcttatatcagcatg
atcagaaccagtctgaagaatatgggttatgtggtgaaaggagatcacacaccgattatt
cctgtagtcattggcgatgcccataaaacggtcctatttgctgaaaaactgcagggcaag
ggaatttatgctcctgccattcggccgccaaccgttgcgccgggtgaaagccggattcga
attacaatcacgtctgaccacagtatgggtgatattgatcatttgctgcaaacatttcat
tcaatcggaaaggagctgcacatcatttga

DBGET integrated database retrieval system