KEGG   Bacillus subtilis subsp. subtilis 168: BSU30230
Entry
BSU30230          CDS       T00010                                 

Symbol
bioA
Name
(RefSeq) adenosylmethionine--8-amino-7-oxononanoate aminotransferase BioA
  KO
K19563  lysine---8-amino-7-oxononanoate aminotransferase [EC:2.6.1.105]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00780  Biotin metabolism
bsu01100  Metabolic pathways
bsu01240  Biosynthesis of cofactors
Module
bsu_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
bsu_M00573  Biotin biosynthesis, BioI pathway, long-chain-acyl-ACP => pimeloyl-ACP => biotin
bsu_M00577  Biotin biosynthesis, BioW pathway, pimelate => pimeloyl-CoA => biotin
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BSU30230 (bioA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.105  lysine---8-amino-7-oxononanoate transaminase
     BSU30230 (bioA)
SSDB
Motif
Pfam: Aminotran_3
Other DBs
NCBI-GeneID: 936286
NCBI-ProteinID: NP_390901
Pasteur: BG11524
BSORF: BG11524
UniProt: P53555 A0A6M4JMC4
Structure
PDB: 
3DOD 3DRD 3DU4

Position
complement(3093343..3094689)
AA seq 448 aa
MTHDLIEKSKKHLWLPFTQMKDYDENPLIIESGTGIKVKDINGKEYYDGFSSVWLNVHGH
RKKELDDAIKKQLGKIAHSTLLGMTNVPATQLAETLIDISPKKLTRVFYSDSGAEAMEIA
LKMAFQYWKNIGKPEKQKFIAMKNGYHGDTIGAVSVGSIELFHHVYGPLMFESYKAPIPY
VYRSESGDPDECRDQCLRELAQLLEEHHEEIAALSIESMVQGASGMIVMPEGYLAGVREL
CTTYDVLMIVDEVATGFGRTGKMFACEHENVQPDLMAAGKGITGGYLPIAVTFATEDIYK
AFYDDYENLKTFFHGHSYTGNQLGCAVALENLALFESENIVEQVAEKSKKLHFLLQDLHA
LPHVGDIRQLGFMCGAELVRSKETKEPYPADRRIGYKVSLKMRELGMLTRPLGDVIAFLP
PLASTAEELSEMVAIMKQAIHEVTSLED
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgactcatgatttgatagaaaaaagtaaaaagcacctctggctgccatttacccaaatg
aaagattatgatgaaaaccccttaatcatcgaaagcgggactggaatcaaagtcaaagac
ataaacggcaaggaatactatgacggtttttcatcggtttggcttaatgtccacggacac
cgcaaaaaagaactagatgacgccataaaaaaacagctcggaaaaattgcgcactccacg
ttattgggcatgaccaatgttccagcaacccagcttgccgaaacattaatcgacatcagc
ccaaaaaagctcacgcgggtcttttattcagacagcggcgcagaggcgatggaaatagcc
ctaaaaatggcgtttcagtattggaagaacatcgggaagcccgagaaacaaaaattcatc
gcaatgaaaaacgggtatcacggtgatacgattggcgccgtcagtgtcggttcaattgag
ctttttcaccacgtatacggcccgttgatgttcgagagttacaaggccccgattccttat
gtgtatcgttctgaaagcggtgatcctgatgagtgccgtgatcagtgcctccgagagctt
gcacagctgcttgaggaacatcatgaggaaattgccgcgctttccattgaatcaatggta
caaggcgcgtccggtatgatcgtgatgccggaaggatatttggcaggcgtgcgcgagcta
tgtacaacatacgatgtcttaatgatcgttgatgaagtcgctacaggctttggccgtaca
ggaaaaatgtttgcgtgcgagcacgagaatgtccagcctgatctgatggctgccggtaaa
ggcattacaggaggctatttgccaattgccgttacgtttgccactgaagacatctataag
gcattctatgatgattatgaaaacctaaaaacctttttccatggccattcctatacaggc
aatcagcttggctgtgcggttgcgcttgaaaatctggcattatttgaatctgaaaacatt
gtggaacaagtagcggaaaaaagtaaaaagctccattttcttcttcaagatctgcacgct
cttcctcatgttggggatattcggcagcttggctttatgtgcggtgcagagcttgtacga
tcaaaggaaactaaagaaccttacccggctgatcggcggattggatacaaagtttcctta
aaaatgagagagttaggaatgctgacaagaccgcttggggacgtgattgcatttcttcct
cctcttgccagcacagctgaagagctctcggaaatggttgccattatgaaacaagcgatc
cacgaggttacgagccttgaagattga

DBGET integrated database retrieval system