KEGG   Bacillus subtilis subsp. subtilis 168: BSU30240
Entry
BSU30240          CDS       T00010                                 

Symbol
bioW
Name
(RefSeq) 6-carboxyhexanoate--CoA ligase
  KO
K01906  6-carboxyhexanoate--CoA ligase [EC:6.2.1.14]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00780  Biotin metabolism
bsu01100  Metabolic pathways
bsu01240  Biosynthesis of cofactors
Module
bsu_M00577  Biotin biosynthesis, BioW pathway, pimelate => pimeloyl-CoA => biotin
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BSU30240 (bioW)
Enzymes [BR:bsu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.14  6-carboxyhexanoate---CoA ligase
     BSU30240 (bioW)
SSDB
Motif
Pfam: BioW
Other DBs
NCBI-GeneID: 938017
NCBI-ProteinID: NP_390902
Pasteur: BG11529
BSORF: BG11529
UniProt: P53559 A0A6M3ZIY3
Structure
PDB: 
5FLG 5G1F 5FLL 5FM0

Position
complement(3094679..3095455)
AA seq 258 aa
MQEETFYSVRMRASMNGSHEDGGKHISGGERLIPFHEMKHTVNALLEKGLSHSRGKPDFM
QIQFEEVHESIKTIQPLPVHTNEVSCPEEGQKLARLLLEKEGVSRDVIEKAYEQIPEWSD
VRGAVLFDIHTGKRMDQTKEKGVRVSRMDWPDANFEKWALHSHVPAHSRIKEALALASKV
SRHPAVVAELCWSDDPDYITGYVAGKKMGYQRITAMKEYGTEEGCRVFFIDGSNDVNTYI
HDLEKQPILIEWEEDHDS
NT seq 777 nt   +upstreamnt  +downstreamnt
atgcaagaagaaactttttatagtgtcagaatgagggcttcaatgaatggatctcatgaa
gacggcggaaagcatatatccggcggagaacggcttattcctttccatgagatgaagcat
acagtcaatgctttattagaaaaagggttatcccattcaagaggaaaacctgattttatg
caaattcaatttgaagaggtacatgaatcgataaaaaccattcagccattgcctgtgcat
acgaatgaagtgagctgcccggaagaaggacaaaagcttgcccgattgttattggaaaaa
gaaggcgtttcacgagacgtgattgaaaaagcatatgaacaaatccctgaatggtcagat
gtcaggggtgcggtgttgtttgatattcatacaggcaagcgaatggatcaaacaaaagaa
aaaggggtgcgggtctccagaatggattggccggacgctaattttgaaaaatgggcgctt
cacagtcacgtgccagctcattcaagaataaaagaggcccttgcgctcgcttcaaaggta
agccggcacccggcagtcgttgcagaattatgctggtcggacgatccggattacataaca
ggctatgttgcgggtaagaaaatgggctatcagcgtattacagcaatgaaagaatacggg
actgaagagggctgccgagtcttttttattgatggatccaatgatgtaaacacgtacata
catgacctggagaagcagcctattttaatagagtgggaggaagatcatgactcatga

DBGET integrated database retrieval system