KEGG   Bacillus subtilis subsp. subtilis 168: BSU30250
Entry
BSU30250          CDS       T00010                                 

Symbol
ytaP
Name
(RefSeq) hydrolase YtaP
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DLH AXE1 Peptidase_S9 Peptidase_S15 Hydrolase_4 Abhydrolase_1 BAAT_C Abhydrolase_6 Abhydrolase_7
Other DBs
NCBI-GeneID: 937263
NCBI-ProteinID: NP_390903
Pasteur: BG11786
BSORF: BG11786
UniProt: O34973 A0A6M3ZF73
Position
complement(3095665..3096564)
AA seq 299 aa
MRAERRKQLFRLLGDLPDRRPISVETLRIEEREENIVETLLLDLNGHEKAPAYFVKPKKT
EGPCPAVLFQHSHGGQYDRGKSELIEGADYLKTPSFSDELTSLGYGVLAIDHWGFGDRRG
KAESEIFKEMLLTGKVMWGMMIYDSLSALDYMQSRSDVQPDRIGTIGMSMGGLMAWWTAA
LDDRIKVCVDLCSQVDHHVLIKTQNLDRHGFYYYVPSLAKHFSASEIQSLIAPRPHLSLV
GVHDRLTPAEGVDKIEKELTAVYAGQGAADCYRVVRSASGHFETAVIRHEAVRFLQKWL
NT seq 900 nt   +upstreamnt  +downstreamnt
atgagagccgaaagaagaaagcaactgtttcgattgcttggtgatttgcctgatcggagg
ccaatcagtgttgagacattacgtattgaagaaagagaagaaaatatcgttgaaacgctc
ctgctcgatttaaatggacatgaaaaggcgcccgcttattttgtgaagccgaagaaaaca
gaaggaccgtgcccagccgtattgtttcagcattcgcatggaggccagtatgatagggga
aaaagtgagctgattgagggagcggattatttgaaaacgccttctttttctgatgagctt
acttcactcggatacggcgttcttgcgattgatcattgggggtttggagatcggcgggga
aaagcggaaagcgagatatttaaagaaatgcttctcaccggaaaagtgatgtgggggatg
atgatttatgacagtttaagtgcgttagactatatgcagtcacgctctgatgttcagcct
gacaggatcggaaccatcggcatgtctatgggaggtttgatggcgtggtggacagcggcg
ctcgatgaccggattaaggtgtgtgtggatttgtgcagccaggtggatcatcacgtgctg
atcaaaacacagaatcttgacaggcacggcttttattattacgtcccatcgcttgcaaag
catttttccgcatcggagatccaaagcctgatcgcgccgcgcccgcaccttagtcttgtt
ggtgtacacgatcggttaacgccggctgagggcgtggacaaaatcgaaaaagaattgaca
gctgtctatgctggacagggagctgctgattgctaccgagtggtccgttctgcttcggga
catttcgaaacagcagttataaggcatgaagctgtccggtttttgcaaaagtggctgtga

DBGET integrated database retrieval system