KEGG   Bacillus subtilis subsp. subtilis 168: BSU30260
Entry
BSU30260          CDS       T00010                                 

Symbol
msmR
Name
(RefSeq) LacI family transcriptional regulator
  KO
K02529  LacI family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU30260 (msmR)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   LacI family
    BSU30260 (msmR)
SSDB
Motif
Pfam: Peripla_BP_3 LacI Peripla_BP_1 Peripla_BP_4
Other DBs
NCBI-GeneID: 937257
NCBI-ProteinID: NP_390904
Pasteur: BG12626
BSORF: BG12626
UniProt: O34829 A0A6M3ZFG8
Position
3096782..3097816
AA seq 344 aa
MVRIKDIALKAKVSSATVSRILNEDESLSVAGETRQRVINIAEELGYQTVAKRRKSRGQK
QRAQPLIGVLSCLSPDQERQDPYFSSIRKGIEKECFEQEIFITNSIHLGSFQEHIFRELD
GVIVIGRVHDEAVKHISGRLEHAVFINHSPDPQAYDSIGIDFESASRQAIDHLFDLGYKR
LGYIGGQEKEHTLKDGQSIRRTIEDKRLTAFLESAAPQPEHVLIGEYSMREGYRLMKKAI
DQGHLPEAFFIASDSMAIGALKALQEAGLQVPRDTAIVSFNGIEEAEFASTPLTTVKVYT
EEMGRTGVKLLLDRLNGRTLPQHVTLPTTLIVRQSCGCTAKEVT
NT seq 1035 nt   +upstreamnt  +downstreamnt
atggttcgtattaaagatatcgccttgaaagctaaagtttccagcgcaactgtgtccaga
attttaaatgaagatgagtcgctttctgttgcgggcgaaacgagacaaagagtcatcaac
atcgctgaagagcttggttatcaaaccgttgccaaacgccgaaaatcccgcgggcaaaaa
cagcgggctcagccgctgatcggtgtgctgagctgtctgtcccctgatcaggaaaggcag
gacccttatttttcttccattcggaaagggattgaaaaggaatgctttgaacaggaaatt
ttcattacaaattcgattcatctcggctcctttcaggaacatatctttcgggaattggat
ggtgtcattgtcatcggccgtgttcatgatgaagcggttaagcatatcagcgggaggctg
gagcatgccgtatttatcaatcattcaccagatccgcaagcatacgattcgattggcatc
gattttgaatcggcttcacgccaggcgattgatcaccttttcgacttaggctacaaacgg
ttaggctacattggcggacaagaaaaagagcatacgctgaaggacggccaaagcattcgc
agaacgattgaagataaacgcctgaccgcttttttggagtcagccgccccccagcctgag
catgtgctgatcggagaatacagcatgcgtgagggctatcgcctgatgaagaaagcaatc
gatcaaggccatctgccggaagcattctttattgccagcgattctatggcgatcggcgca
ttaaaagcgctgcaggaagccggactgcaagtgccgcgggataccgcaatcgtcagcttt
aacggcattgaggaagctgaatttgccagcacgcctttaacgacggtgaaggtatacaca
gaggaaatgggccggacaggcgtaaaactgctgcttgaccgtctcaatggccgaacgctt
cctcaacatgtcaccctgcctacaacattaatcgtaagacaaagctgcggatgtacagca
aaggaggtgacataa

DBGET integrated database retrieval system