KEGG   Bacillus subtilis subsp. subtilis 168: BSU30270
Entry
BSU30270          CDS       T00010                                 

Symbol
msmE
Name
(RefSeq) sugar ABC transporter substrate-binding protein
  KO
K10117  raffinose/stachyose/melibiose transport system substrate-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU30270 (msmE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU30270 (msmE)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Raffinose/stachyose/melibiose transporter
    BSU30270 (msmE)
SSDB
Motif
Pfam: SBP_bac_1 SBP_bac_8 SBP_bac_11
Other DBs
NCBI-GeneID: 936693
NCBI-ProteinID: NP_390905
Pasteur: BG12625
BSORF: BG12625
UniProt: O34335 A0A6M3ZFE7
Structure
PDB: 
4R6H

Position
3097850..3099130
AA seq 426 aa
MKHTFVLFLSLILLVLPGCSAEKSSADTAKKTLTIYSTMSTDSERDTFRKLAAAFEKEHS
DIHVSLHFPGNDYENMMRVRMAANDLPDLFDTHGWGKIRYGEYTADLRDMKWTQDLDPNL
NSILKNKSGKVYAYPINQAKDGLAYNRNILDRYGIAPPETMDDFIKALRTIKEKSKGSIV
PFWFAGYDKSSFAQYYDQFATPLLITDPAHNEKKQLINGTFQWSKFTYLSEILKQMQKEK
LINIDAVTAKKSQLIELMAQNKIAFTMQGGTLGQDVAQINPNVKVGIIPTPAIHPGDDPI
WIGGERYTLAAWKDSPQLKEAKDFIAFMARPANAKQMAEATSLPSGLTNVKADIFYANDY
EYYQDVKVEPYFDRLYLPNGMWDVLGTVGQELAADILAPQDISQKLGREYKRLREQSETQ
GAENNE
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgaaacacacttttgttttatttctctctcttattctgcttgttctgcccgggtgttca
gcagagaaaagctcagcagataccgcaaaaaagacgttaaccatttattctacaatgtca
accgacagtgaaagagatacgttcagaaaactagcggcagcattcgaaaaggaacacagt
gacattcatgtcagccttcatttcccaggcaatgactatgaaaatatgatgcgtgtcaga
atggcggccaatgatttgccagatctattcgatacacatggctgggggaaaatcaggtac
ggagaatatacagcggatctccgggatatgaaatggactcaagatcttgatcccaattta
aacagcatcctcaaaaataaaagcggaaaggtgtatgcctatccaatcaatcaggcaaaa
gacggtctggcgtataatcgcaatattttagaccgttacggcattgctccgccggaaacc
atggatgactttatcaaagcactgagaacgattaaagaaaagagcaagggaagcattgtt
cccttctggtttgccggatatgacaaaagctcattcgcccaatattacgaccaattcgct
acacctcttctcatcacagaccctgcccataatgaaaaaaaacagctcatcaacggcact
tttcaatggagtaaattcacttatttatcagaaatcctcaaacaaatgcagaaagaaaaa
ttgatcaatatcgacgccgtcacggcaaaaaaatcacagctcattgaattaatggcccaa
aacaaaatcgcctttacaatgcaaggcggcacactcggccaagacgttgcccagatcaac
ccgaacgtcaaggtcggcattatcccgacacctgccatccatcccggtgatgacccgata
tggatcggcggtgaacgctacacccttgcagcatggaaagattcgcctcaattaaaagag
gcaaaagattttatcgcatttatggcccgcccggccaatgccaaacaaatggctgaagcc
acatcgcttccttcagggctgaccaatgtgaaagctgatattttctacgcaaacgattat
gagtattatcaagatgtcaaagtcgagccttacttcgaccggttatacttgccaaacgga
atgtgggatgtcctgggcacggttgggcaggagctcgcggctgacattttggcgcctcaa
gacatttcgcagaagctgggaagagaatataaacgactccgggagcaatccgaaacacag
ggagctgaaaacaatgagtga

DBGET integrated database retrieval system