KEGG   Bacillus subtilis subsp. subtilis 168: BSU30280
Entry
BSU30280          CDS       T00010                                 

Symbol
amyD
Name
(RefSeq) ABC transporter permease
  KO
K10118  raffinose/stachyose/melibiose transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU30280 (amyD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU30280 (amyD)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Raffinose/stachyose/melibiose transporter
    BSU30280 (amyD)
SSDB
Motif
Pfam: BPD_transp_1 CCSMST1
Other DBs
NCBI-GeneID: 937258
NCBI-ProteinID: NP_390906
Pasteur: BG12565
BSORF: BG12565
UniProt: O34706 A0A6M4JL23
Position
3099123..3100034
AA seq 303 aa
MSEIARDVHVKQVKPKKQSSLWWMYIPALLSVLVFMIYPFVKGTLITFTNWNGFSQVYQW
VGFAQYERLFSDPDTWHILKNTLHYGLGSTFFQNVVGLLYALLLNQSIKTKAVTRTIVYL
PVMISPLIMGYIWYFFFSYDGGALNDLLGVFGISPINALASPSLNPWIIVMINTYQYVGI
AMVVYLAGLQSIPKDYYEAAQMDGAKQGQQFFTITLPLLMPSITINIVINIIGGLKLFDV
IIALTAGGPGNASQSMSTFMYDLYFKRQDAGYAATQGIFMAFVILIISFCALAYFKRKET
EMS
NT seq 912 nt   +upstreamnt  +downstreamnt
atgagtgagatcgcaagggacgttcatgtgaaacaggttaagccaaaaaagcagtcctca
ctttggtggatgtacattcctgctttgctctccgttctggtctttatgatttacccgttt
gtgaaaggcacattgattacctttacaaactggaacggattttcacaagtctaccaatgg
gttggattcgcgcaatatgaaaggctgttttctgatcctgatacttggcatatcttaaaa
aacacgctgcattacgggcttggcagcaccttttttcaaaatgtggtcgggcttctgtac
gctctcctcttaaatcaaagcattaaaacgaaagcggtaacaagaacaattgtgtatttg
ccggtgatgatcagcccgctcattatgggctacatttggtactttttcttctcctatgac
ggaggcgcgctcaacgatttgctcggggtcttcggcatcagccctattaatgcgctcgcc
agtccctcgctcaatccatggatcattgtcatgattaacacctatcaatatgtcgggatc
gctatggttgtctacttagccggtctgcaaagcattccgaaagactactatgaagcggcg
caaatggatggcgcgaaacaaggccagcagttttttaccatcacgctgccgctgttaatg
ccctccattaccattaatatagtcatcaacattatcggaggcttaaagctgtttgacgtc
atcattgcactcaccgcaggcggccccggaaatgcgtcacaatccatgtccacgtttatg
tatgatttgtatttcaaacggcaggatgccggctatgccgcaacgcaaggcatatttatg
gcatttgtcattttgatcatcagcttttgcgcgcttgcgtactttaaaagaaaggagacg
gaaatgtcatga

DBGET integrated database retrieval system