KEGG   Bacillus subtilis subsp. subtilis 168: BSU30290
Entry
BSU30290          CDS       T00010                                 

Symbol
amyC
Name
(RefSeq) ABC transporter permease
  KO
K10119  raffinose/stachyose/melibiose transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU30290 (amyC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU30290 (amyC)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Raffinose/stachyose/melibiose transporter
    BSU30290 (amyC)
SSDB
Motif
Pfam: BPD_transp_1
Other DBs
NCBI-GeneID: 935927
NCBI-ProteinID: NP_390907
Pasteur: BG12564
BSORF: BG12564
UniProt: O34518 A0A6M4JNY6
Position
3100031..3100861
AA seq 276 aa
MRAARTKSMRIITLLAAIVACAHFIPFYILLTTSLKAKGDYSSKWIFPADISFHNFSEAW
ERASLGNSFINTMIITGFSALLLIIFGSLAAYPLARRETKLNKAVFALLISIMIIPPLTS
MVPLYRMVVDAGMVNTHAIAIFINTAAYMPLTVFLYSGFIRSTIPKELVEAARIDGAGML
KIFFTIVFPLLKPITATICIISCVFIWNDYQFAIFFLQDQKVQTLTVAMAGFFGENANNL
HLVAAAALMAMLPMVVLFLALQKYFIAGLSSGAVKG
NT seq 831 nt   +upstreamnt  +downstreamnt
atgagagccgcccgtacaaaaagcatgcggatcattacgcttcttgcagccattgtggcc
tgtgcgcattttattcctttttatatcctgctgaccacttcattgaaagcaaaaggagac
tacagttcgaaatggatatttccagccgacatctcctttcataatttttcagaggcgtgg
gagcgcgcttcgctaggaaactcttttataaacaccatgatcatcacaggtttttctgcc
ttgttattaattatattcggctcacttgccgcctacccgcttgcccggcgggaaacgaaa
ctgaataaagccgtttttgccttgctgatttccattatgatcatccctccgttaacgtcc
atggttcctttgtaccgaatggtcgtggacgccggaatggtcaatacacacgcaatcgcc
attttcatcaatacagcggcttacatgccgttaaccgtattcttatattcaggctttatc
cgatcgaccattccaaaagagcttgtagaagccgcaagaattgacggtgcaggcatgctg
aaaatcttttttacgattgtgtttcctctgctgaagccgatcactgcgaccatctgtatc
atttcttgtgtctttatttggaacgactatcaatttgccattttctttttacaagatcaa
aaggttcagacattaacagtagccatggcaggttttttcggagaaaacgcaaacaacctt
catttagttgccgcagcggcacttatggcaatgctgccgatggttgttctgtttttggcg
ctgcaaaaatactttattgccggcctgtcttccggagcggtaaagggttaa

DBGET integrated database retrieval system