KEGG   Bacillus subtilis subsp. subtilis 168: BSU30300Help
Entry
BSU30300          CDS       T00010                                 

Gene name
melA
Definition
(RefSeq) alpha-galactosidase
  KO
K07406  alpha-galactosidase [EC:3.2.1.22]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00052  Galactose metabolism
bsu00561  Glycerolipid metabolism
bsu00600  Sphingolipid metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    BSU30300 (melA)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    BSU30300 (melA)
   00600 Sphingolipid metabolism
    BSU30300 (melA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     BSU30300 (melA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4 Glyco_hydro_4C
Motif
Other DBs
NCBI-GeneID: 937255
NCBI-ProteinID: NP_390908
Pasteur: BG12615
BSORF: BG12615
UniProt: O34645
Position
3100881..3102179
Genome map
AA seq 432 aa AA seqDB search
MKKITFIGAGSTIFAKNVLGDCLLTEALNGFEFALYDIDPKRLQESQLMLENLRDRYNPS
VAINSYDDRKLALQNAGYVINAIQVGGYKPSTVIDFEIPKRYGLRQTIADTVGIGGIFRS
LRTIPVLFDIAKDMEEMCPDAWFLNYTNPMATLTGAMLRYTNIKTIGLCHSVQVCTKDLF
KALGMEHDGIEERIAGINHMAWLLEVKKDGTDLYPEIKRRAKEKQKTKHHDMVRFELMDK
FGYYVTESSEHNAEYHPYFIKRNYPELISELQIPLDEYPRRCVKQIENWEKMRDDIVNNK
NLTHERSKEYGSRIIEAMETNEPFTFGGNVLNTGLITNLPSKAVVEVTCVADRKKITPCF
AGELPEQLAALNRTNINTQLMTIEAAVTRKKEAVYQAAMLDPHTSAELSMKDIISMCDDL
FAAHGDWLPEYK
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagattacatttatcggtgcagggagcacgattttcgccaaaaatgttttggga
gactgcctgttaacagaggcactgaatggatttgagttcgctctttacgacattgatccc
aaacgcctgcaggaatcccagctcatgctcgaaaatctaagagaccgttataacccaagt
gtggccatcaacagctatgatgacagaaaactcgccttgcaaaacgcaggctatgtcatc
aatgcgattcaggttggaggatacaaaccgagcacagtcatcgatttcgagattcctaaa
cggtatgggctgcgccagacgatcgccgatacagtaggcatcggcgggatattcagatct
ctcagaacaatcccggtcttatttgatatcgcaaaagatatggaggaaatgtgccctgac
gcatggttcttaaactatacaaatccaatggccactcttacaggcgccatgctccgctat
accaatatcaaaacaatcgggctctgccacagtgttcaagtgtgcacgaaggatttattt
aaagctctcggaatggagcatgacggaattgaggaacgcattgcgggcattaatcatatg
gcttggcttttggaagtcaaaaaagacggcacagatttatatccagaaatcaaaaggaga
gcgaaagaaaaacaaaaaacaaagcatcatgatatggtgcggtttgaattaatggataag
ttcggctattatgtcacggaatcgtccgaacataacgcagagtatcacccgtactttatt
aaacggaattaccctgaactgatcagcgagctgcaaatcccgctcgacgaatatccgaga
aggtgcgtcaagcagattgaaaattgggagaaaatgcgggatgatatcgtcaataataaa
aaccttacgcacgaacgctcaaaggaatatggttcaagaattatagaagcaatggaaaca
aacgaaccattcaccttcggaggaaacgtcttgaatacagggctgatcaccaaccttcct
tcaaaagcggttgtggaagtgacatgcgtcgccgacagaaaaaaaattacaccgtgcttc
gccggagaactgcctgagcagcttgcagccttaaaccggacgaatattaatacacagctg
atgacaatcgaagcggctgtcacacgaaaaaaagaagcggtttaccaagctgcaatgctt
gatccgcatacaagcgcggagctttccatgaaggacatcatctccatgtgcgacgattta
tttgcagcacacggcgattggcttccggaatacaaataa

DBGET integrated database retrieval system