KEGG   Bacillus subtilis subsp. subtilis 168: BSU30310
Entry
BSU30310          CDS       T00010                                 

Symbol
ytwF
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Rhodanese
Other DBs
NCBI-GeneID: 936589
NCBI-ProteinID: NP_390909
Pasteur: BG13932
BSORF: BG13932
UniProt: O32072 A0A6M3ZFX1
Position
complement(3102201..3102512)
AA seq 103 aa
MEIKEISTAALKEKIEADEELYLIDVREDEEVAEGMIPQAVHIRMGDIPEKMETLDKDKE
YVFICRSGMRSMNVCKYLDEQGFKTVNVEGGMMAWEGETKPKN
NT seq 312 nt   +upstreamnt  +downstreamnt
ttggaaataaaagaaatcagcacagccgctttgaaagaaaaaattgaggcggacgaagaa
ttatatttaattgatgtcagagaagatgaagaggtagcggaaggcatgatcccgcaagcc
gttcatattcgcatgggggatattcctgaaaaaatggaaacccttgataaagacaaagag
tacgtatttatctgccgctcaggaatgcgcagcatgaacgtctgcaagtacctggatgag
caaggctttaaaacagtcaatgttgaaggcggcatgatggcctgggaaggcgaaacaaaa
ccaaaaaactag

DBGET integrated database retrieval system