KEGG   Bacillus subtilis subsp. subtilis 168: BSU30330
Entry
BSU30330          CDS       T00010                                 

Symbol
ytvB
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF4257 DUF3397
Other DBs
NCBI-GeneID: 937249
NCBI-ProteinID: NP_390911
Pasteur: BG13929
BSORF: BG13929
UniProt: O34881 A0A6M3ZIS1
Position
complement(3105470..3105799)
AA seq 109 aa
MLHQVLIACVIGGIMGILGHVKKRGRLEKPRMTKRFIYLGFLEDWFIGMTASILLVLSAD
PDSGIQLVILSIISGYGGEAVLRSFDFVRELNSGGEPAESKRQTKTPPE
NT seq 330 nt   +upstreamnt  +downstreamnt
atgctgcatcaggtactcattgcttgtgtaattggaggaatcatggggattctcggtcat
gtgaaaaagagaggcaggctggagaagcccagaatgacgaagcggtttatctaccttgga
tttttggaagattggtttatcggcatgacggcttccattttacttgtattatccgctgac
cccgattcaggaattcaacttgtcatcttatccattatctcaggctacggcggtgaagct
gttctcagaagttttgactttgtgagagaactgaacagcggcggcgaaccggccgagtcc
aaacgtcaaaccaaaactccacccgaataa

DBGET integrated database retrieval system