KEGG   Bacillus subtilis subsp. subtilis 168: BSU30350
Entry
BSU30350          CDS       T00010                                 

Symbol
yttB
Name
(RefSeq) MFS transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MFS_1 MFS_1_like MFS_2 OATP
Other DBs
NCBI-GeneID: 936526
NCBI-ProteinID: NP_390913
Pasteur: BG13925
BSORF: BG13925
UniProt: O34546 A0A6M4JML4
Position
complement(3107232..3108425)
AA seq 397 aa
MPRALKILVIGMFINVTGASFLWPLNTIYIHNHLGKSLTVAGLVLMLNSGASVAGNLCGG
FLFDKIGGFKSIMLGIAITLASLMGLVFFHDWPAYIVLLTIVGFGSGVVFPASYAMAGSV
WPEGGRKAFNAIYVAQNAGVAVGSALGGVVASFSFSYVFLANAVLYLIFFFIVYFGFRNI
QTGDASQTSVLDYDAVNSKAKFAALIILSGGYVLGWLAYSQWSTTIASYTQSIGISLSLY
SVLWTVNGILIVLGQPLVSFVVKKWAESLKAQMVIGFIIFIVSFSMLLTAKQFPMFLAAM
VILTIGEMLVWPAVPTIANQLAPKGKEGFYQGFVNSAATGGRMIGPLFGGVLVDHYGIRA
LVLSLLVLLLISIATTLLYDKRIKSAKETNKQASISS
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgccgcgtgctcttaaaattttagtcattggaatgtttatcaatgtgacgggtgcttct
tttttatggccgctgaatacgatttatatccataatcatttaggaaagtcgttaacagta
gccggacttgtcctgatgctgaattccggcgccagtgtggctggcaatttatgcggaggt
tttttgtttgataaaatcggcggttttaaatcgattatgcttgggatagccattacgtta
gcaagcctgatgggtcttgtcttttttcatgattggccagcctatattgtgctgctgacg
attgtgggctttggctccggtgttgtttttccggcaagctacgcaatggcgggatcggta
tggcctgaagggggaaggaaggcatttaatgcgatatatgtcgcgcaaaacgcgggcgtg
gccgttggttcagcgcttggcggtgtcgtggcatctttctcgttttcatatgtatttttg
gcaaatgccgtattgtatctgatctttttctttattgtatatttcggatttcgaaatatt
caaacgggcgatgcatcccaaacatccgtgcttgattatgatgctgtgaacagcaaagca
aaatttgccgcactgatcattttaagcggaggctatgtactcggatggctggcttattct
cagtggtcaaccacaattgcttcgtacacacaaagcattggaatatctctttccttatac
agcgtgctgtggacggttaacggaattctcattgtgctcggccagccgctcgtcagtttt
gtggtgaaaaaatgggccgagtcgctaaaagcgcaaatggtcatcggctttatcattttt
attgtgtctttcagcatgctgctgactgcaaagcaatttccgatgtttctcgctgcgatg
gtgatcctgactatcggagaaatgcttgtttggcctgctgtgccgactattgccaatcag
cttgcccctaaagggaaagaaggcttttatcaaggctttgtcaacagtgcggcgacaggc
ggcagaatgattggtcccctgttcggaggagtgcttgtcgatcattacggcattagggct
cttgttttatctctgttggtattgctgctgatcagtattgccacaacgcttctatatgac
aaacggataaaatcagctaaagaaacaaataagcaggcatcaatctcttcataa

DBGET integrated database retrieval system