KEGG   Bacillus subtilis subsp. subtilis 168: BSU30360
Entry
BSU30360          CDS       T00010                                 

Symbol
yttA
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: LMBR1 ZapB CENP-F_leu_zip KASH_CCD Crescentin V_ATPase_I GAS DivIC CALCOCO1 APG6_N HALZ DUF3450 Seryl_tRNA_N YabA CoV_S2 DUF4407 MIS13 Wzy_C DUF4131 O-antigen_lig Ada_Zn_binding DUF2909 DUF4201 DUF3810 DUF2968 ATG14 Saf4_Yju2 Golgin_A5 Exonuc_VII_L EzrA Nup88
Other DBs
NCBI-GeneID: 937248
NCBI-ProteinID: NP_390914
Pasteur: BG13924
BSORF: BG13924
UniProt: Q795Q5 A0A6M3ZF82
Position
3108614..3109360
AA seq 248 aa
MEMVLAFLGFLACLIALGYGLYHLVRYVLKKEKRFSKRLFWPLFIGGLVLLFTGAALAEP
DTAAANAEKKYSALNAEYKNLTKEHEELEKEYKSVSSEAKKLKDNKEDQDKLEKLKNENS
DLKKTQKSLKAEIKELQENQKQLKEDAKTAKAENETLRQDKTKLENQLKETESQTASSHE
DTGSSSNNTSKSDETKTADKAEGCNIKGSRNGIYHTPGSTYYDRTTDPAEMFCSVEEAEA
AGYRAPKR
NT seq 747 nt   +upstreamnt  +downstreamnt
atggaaatggtattagcattcttaggttttctggcatgtctcattgcactgggctatgga
ttatatcaccttgtcagatatgtactgaaaaaggaaaaacgtttctcaaagagacttttt
tggccgcttttcattggaggccttgtgctgctctttaccggggcagcattggcagaacct
gacactgccgcagcaaatgccgagaaaaaatattcagcgctaaacgccgaatataaaaac
ctcacaaaagagcacgaagaacttgagaaagaatataaatctgtcagctctgaagcaaag
aaattaaaagacaacaaagaagatcaagacaagcttgagaagcttaaaaacgaaaatagc
gatctaaaaaagactcagaaatcattaaaagctgagattaaagagcttcaagaaaatcaa
aagcagctcaaagaagatgcaaaaacggcaaaggctgaaaatgaaacacttcgacaagat
aaaacaaagcttgaaaatcaattaaaagagacggaaagccaaaccgccagctctcatgaa
gacactggaagttcttcaaacaatacgagtaaaagtgatgaaaccaaaacagctgacaaa
gcagaaggctgtaatatcaaaggaagcagaaacggcatctaccacacgccaggcagtaca
tactacgaccggacaaccgatccggctgaaatgttttgctcagttgaagaagctgaagcc
gccggttatcgggcgccaaaacgataa

DBGET integrated database retrieval system