KEGG   Bacillus subtilis subsp. subtilis 168: BSU30370Help
Entry
BSU30370          CDS       T00010                                 

Gene name
bceB
Definition
(RefSeq) bacitracin export permease protein BceB
  KO
K11632  bacitracin transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU30370 (bceB)
  09132 Signal transduction
   02020 Two-component system
    BSU30370 (bceB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU30370 (bceB)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Bacitracin transporter
    BSU30370 (bceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FtsX
Motif
Other DBs
NCBI-GeneID: 938178
NCBI-ProteinID: NP_390915
Pasteur: BG13921
BSORF: BG13921
UniProt: O34741
Position
complement(3109397..3111337)
Genome map
AA seq 646 aa AA seqDB search
MNINQLILRNLKKNLRNYYLYVFALIFSVALYFAFVTLQYDPAINEVKASIKGAAAIKTA
SILLVAVVAIFILYANTIFIKRRSKEIGLFQLIGMTKHKIFRILSAENVMLYFGSLAIGV
AAGFSISKLVLMILFKIVDVKADAKLHFSEQALVQTVIVFCGIYLLIMIMNYTFIKKQSI
LSLFKVTSSTEDKVKKISFFQMLIGALGIVLILTGYYVSSELFGGKFKTINELFVAMSFI
LGSVIIGTFLFYKGSVTFISNIIRKSKGGYLNISEVLSLSSIMFRMKSNALLLTIITTVS
ALAIGLLSLAYISYYSSEKTAEQNVAADFSFMNEKDAKLFENKLRESNISFVKKATPVLQ
ANVDIANIMDGTPKEMQGDPGNMQLAVVSDKDVKGVDVAAGEAVFSGYTDLLQKIMVFKD
SGVIKVKSKHETQPLKYKGLREEFLVSYTFTSGGMPAVIVDDSLFKQLDKDKDPRIQLAQ
STFIGVNVKHDDQMEKANELFQQVNKKNEHLSRLDTSAAQKSLFGMVMFIVGFLGLTFLI
TSGCILYFKQMGESEDEKPSYTILRKLGFTQGDLIKGIRIKQMYNFGIPLVVGLFHSYFA
VQSGWFLFGSEVWAPMIMVMVLYTALYSIFGFLSVLYYKKVIKSSL
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgaacattaatcagctcatcctgcgaaatttgaaaaagaatctccggaattactatttg
tatgtgtttgcgctcatctttagcgtggcgctttatttcgcctttgtcacgctgcagtat
gatccagcaattaacgaagtgaaggcttcaatcaagggagccgcggctattaaaaccgct
tcgattttgcttgtggctgtagtggcgatcttcattttatatgccaatacgatttttatt
aagagacggagtaaagaaatcgggctgtttcaattaattggaatgacgaagcataaaatt
tttcgcatcttaagtgcagaaaatgtcatgctgtatttcggttcattagcgatcggggta
gcggccgggttttcgatatcgaagcttgtcttgatgattctgttcaaaattgtcgatgtc
aaagcggatgcgaaactgcatttttctgagcaggccttggtccaaacggtcattgtgttc
tgcggcatttaccttttgatcatgatcatgaattatacgtttatcaaaaaacagagtatt
ttatctttgtttaaagtaacgtcctccactgaagacaaagtgaagaaaatatcatttttc
caaatgctgatcggcgctttaggcatcgtgttgattttgacaggatactatgtgtcttct
gagctgtttggcggaaaatttaagaccattaatgaactgtttgttgcgatgagcttcatt
ctggggagcgtcattatcgggacgtttttgttttataaaggatcagttacgtttatctcg
aatatcattcgaaaaagcaagggcggctacttaaatatttctgaggttctgtcactgtct
tcgatcatgttcagaatgaaatcgaatgcgctgctgctgacgattattacaaccgtttca
gcgctcgccatcgggctgttatctcttgcttacatctcgtattactcgtcggaaaagacc
gctgaacaaaatgtagcggctgatttttcattcatgaatgagaaagatgccaagttattt
gaaaacaaattgagggaaagcaacatctcgtttgtaaaaaaggcaacacctgtcctgcaa
gcaaatgttgacattgcaaatattatggatggaactccgaaagagatgcagggcgatccc
ggcaatatgcagcttgctgttgttagcgacaaagatgtaaaaggagtcgatgtggcggct
ggagaagccgttttctcaggatacaccgacttgctgcaaaaaataatggttttcaaggac
tctggtgttattaaagtaaaaagcaagcacgagacgcagccattaaaatataaaggatta
agagaagagtttcttgtgtcctacacgtttacaagcgggggcatgcccgctgtcattgtg
gatgacagcctgtttaaacagctggacaaggataaagacccccgcattcagctggcgcaa
tctacatttatcggcgtcaatgtgaaacatgacgatcaaatggaaaaagcaaatgagctt
tttcaacaggtgaacaagaaaaacgagcatttatcaagactagatacaagcgctgcgcaa
aaatcactgtttggtatggtgatgttcatcgtcggcttcttagggttaacgttcctgatt
acatcaggttgtatcctttattttaaacaaatgggtgaaagtgaagatgaaaaaccgagc
tatacaattttaagaaaactcggctttacgcagggcgacctgataaaggggatacgcatc
aaacaaatgtacaacttcggcattccgctcgttgtcggcctcttccacagttactttgcc
gtccaatccggctggttcttattcggatcagaggtatgggcgcctatgattatggtgatg
gtgttatatactgcgctctactccatttttggttttctgtcagttctttattataagaag
gtcattaaatcgtcgttgtga

DBGET integrated database retrieval system