KEGG   Bacillus subtilis subsp. subtilis 168: BSU30380
Entry
BSU30380          CDS       T00010                                 

Symbol
bceA
Name
(RefSeq) bacitracin export ATP-binding protein BceA
  KO
K11631  bacitracin transport system ATP-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU30380 (bceA)
  09132 Signal transduction
   02020 Two-component system
    BSU30380 (bceA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU30380 (bceA)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Bacitracin transporter
    BSU30380 (bceA)
SSDB
Motif
Pfam: ABC_tran AAA_21 AAA_25 RsgA_GTPase AAA_16 AAA_29 AAA_22 AAA_28 AAA_30 SMC_N MMR_HSR1 AAA_18 cobW FtsK_SpoIIIE dNK ATPase_2 NB-ARC AAA_33 DO-GTPase2 Zeta_toxin T2SSE MobB NACHT AAA_23 DAHP_snth_FXD ATP_bind_1
Other DBs
NCBI-GeneID: 937246
NCBI-ProteinID: NP_390916
Pasteur: BG13920
BSORF: BG13920
UniProt: O34697 A0A6M4JL34
Position
complement(3111327..3112088)
AA seq 253 aa
MVILEANKIRKSYGNKLNKQEVLKGIDIHIEKGEFVSIMGASGSGKTTLLNVLSSIDQVS
HGTIHINGNDMTAMKEKQLAEFRKQHLGFIFQDYNLLDTLTVKENILLPLSITKLSKKEA
NRKFEEVAKELGIYELRDKYPNEISGGQKQRTSAGRAFIHDPSIIFADEPTGALDSKSAS
DLLNKLSQLNQKRNATIIMVTHDPVAASYCGRVIFIKDGQMYTQLNKGGQDRQTFFQDIM
KTQGVLGGVQHEH
NT seq 762 nt   +upstreamnt  +downstreamnt
atggtgattttagaagcgaataaaattcgaaaaagttatggaaacaagctgaataaacag
gaagtgctgaagggcatcgatattcacattgaaaagggcgaattcgtcagtattatgggt
gcttccgggtcgggaaaaaccactttgctcaacgttctgtcctcaatcgatcaggtcagt
cacggaaccattcatattaatggaaatgacatgacggctatgaaggaaaagcagctggct
gaatttagaaaacagcatttaggctttatctttcaggattacaatttgttagacacattg
acagtgaaagagaatatccttctgcctttatcgatcacgaaactatcaaaaaaggaagcc
aatcgcaagtttgaggaagttgccaaggaactgggaatatatgaattgcgggataaatac
ccgaatgaaatttccggcggccagaagcagagaacatccgctggaagagcgtttattcat
gacccgagcattattttcgctgatgaaccgaccggcgcgctcgattcgaaatcggcctcc
gatctattaaataagctgagccagctcaatcaaaaacgcaacgcgacgattattatggtt
acccatgatcccgtcgctgccagctactgcggcagagtcatttttattaaggacgggcaa
atgtatacacagctgaataaagggggccaggacaggcaaacgtttttccaggatattatg
aaaacgcaaggcgtgttaggcggggtgcagcatgaacattaa

DBGET integrated database retrieval system