KEGG   Bacillus subtilis subsp. subtilis 168: BSU30390
Entry
BSU30390          CDS       T00010                                 

Symbol
bceS
Name
(RefSeq) sensor protein BceS
  KO
K11629  two-component system, OmpR family, bacitracin resistance sensor histidine kinase BceS [EC:2.7.13.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU30390 (bceS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bsu01001]
    BSU30390 (bceS)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU30390 (bceS)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     BSU30390 (bceS)
Protein kinases [BR:bsu01001]
 Histidine kinases
  OmpR family
   BSU30390 (bceS)
Two-component system [BR:bsu02022]
 OmpR family
  BceS-BceR (bacitracin transport)
   BSU30390 (bceS)
SSDB
Motif
Pfam: HATPase_c HATPase_c_3 HATPase_c_2 IPP-2
Other DBs
NCBI-GeneID: 936816
NCBI-ProteinID: NP_390917
Pasteur: BG13919
BSORF: BG13919
UniProt: O35044 A0A6M3ZIN3
Position
complement(3112190..3113194)
AA seq 334 aa
MIKAFLIERRSWIAAFLFQQALMLFIAFVDPSISFGNVLYMVYLCILFFIIFLWFRYRKE
TAFYKSLKTWENNLDVTAINEPETPFEAMVERSIAGQTEHLKQTAARHRLALENEKDELM
AWIHEVKTPLTAMHLIIDRMEEKALKSQLSYEWLRIHLLLDQQLHQKRISFIENDLSVEF
IQLQPLIFKEIKDLQSWCIQKGIGFDIQLEAKEVLSDAKWLAFIIRQLLTNAVKYSEASE
IEIKSFQKGEQTQLQVKDCGRGIDPKDVPRIFDKGFTSTTDHHDQASTGMGLYLAKKAAA
PLLIHIDVESEFGAGTVFTLTFPIRNQFEHVISV
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgattaaagcattccttatcgaaaggcggagctggattgccgcgtttttgtttcagcag
gctttgatgctgttcattgcttttgtcgatccttccatatcatttgggaatgtactttat
atggtgtatttgtgcatcttgttttttatcatattcctttggttccgctatcggaaagaa
acagcgttttataaaagcttgaaaacatgggagaacaatctcgatgtgacagccataaat
gaaccggaaacgccgtttgaagcaatggttgaaagaagcattgccgggcaaacagaacac
ttgaagcagaccgcagcacggcatcgcttagcattggaaaatgaaaaagatgagctgatg
gcatggatccatgaggtcaaaactccattaacagcgatgcatttaatcattgatagaatg
gaagaaaaagcactgaaatcccagctgtcatatgaatggctgcgtattcacctgcttctt
gatcagcagcttcatcaaaaacgcatttcatttattgaaaacgacctgtcagtagaattc
attcagcttcagcctttgatctttaaagaaatcaaagatttacaatcgtggtgtatccaa
aaagggatcggttttgacatacagctcgaggccaaagaagtgctgagcgatgcaaaatgg
ctggcgtttatcatcaggcagctgctgacaaacgcggtgaaatacagcgaagcctctgaa
atcgagatcaaaagctttcaaaaaggggaacagacgcagctccaagtgaaagattgtggc
aggggcattgatccaaaagatgtaccgcgtatttttgataaagggtttacatccacaacg
gatcaccatgatcaagcgtcaactggcatggggctgtacttggcaaaaaaagcagcggcg
ccgttattgatccatattgatgttgagtcggagtttggtgcgggaacagtttttacatta
acctttccaatacggaatcaatttgaacatgtcataagcgtgtga

DBGET integrated database retrieval system