KEGG   Bacillus subtilis subsp. subtilis 168: BSU30400
Entry
BSU30400          CDS       T00010                                 

Symbol
bceR
Name
(RefSeq) sensory transduction protein BceR
  KO
K11630  two-component system, OmpR family, bacitracin resistance response regulator BceR
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU30400 (bceR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU30400 (bceR)
Two-component system [BR:bsu02022]
 OmpR family
  BceS-BceR (bacitracin transport)
   BSU30400 (bceR)
SSDB
Motif
Pfam: Trans_reg_C Response_reg
Other DBs
NCBI-GeneID: 936307
NCBI-ProteinID: NP_390918
Pasteur: BG12340
BSORF: BG12340
UniProt: O34951 A0A6M4JRH9
Position
complement(3113187..3113882)
AA seq 231 aa
MFKLLLIEDDESLFHEIKDRLTGWSYDVYGIQDFSQVLQEFAAVNPDCVIIDVQLPKFDG
FHWCRLIRSRSNVPILFLSSRDHPADMVMSMQLGADDFIQKPFHFDVLIAKIQAMFRRVH
HYNTEPSTIKTWCGAAVDAEQNLVSNDKGSVELTKNEMFILKQLIEQKNKIVSREELIRS
LWNDERFVSDNTLTVNVNRLRKKLDALQLGAYIETKVGQGYIAKEEDKFYD
NT seq 696 nt   +upstreamnt  +downstreamnt
ttgtttaaacttttgctgattgaagatgatgaatcgctgtttcatgaaatcaaggatcgt
ttaacgggatggtcctatgatgtatacggcattcaggatttcagtcaggtgctgcaggaa
tttgcggcggttaatcctgattgtgtcattattgatgtgcagctgcctaaatttgacggc
tttcattggtgccgtctgatccgctcccggtcaaatgttccgattctctttttatcctcc
cgggatcatcctgctgatatggtgatgtccatgcagctcggggcagatgactttattcaa
aagccatttcattttgatgtgctgatcgcgaaaatccaagcgatgttccggcgtgtgcac
cattataatacggagccgagtacgattaaaacgtggtgcggcgctgctgtagacgcggag
cagaacctcgtcagcaatgacaaaggatctgttgaactgaccaaaaatgaaatgttcatt
ctaaaacaattaatagagcaaaaaaacaagatcgtcagccgggaagagctgatcagaagc
ttgtggaacgatgagcgttttgttagtgataatacgctgaccgtcaatgtcaatcgcctg
cgaaaaaaactggacgccctgcagcttggtgcatatatcgagacaaaggtgggccagggc
tacatcgcgaaggaagaggacaagttctatgattaa

DBGET integrated database retrieval system