KEGG   Bacillus subtilis subsp. subtilis 168: BSU30430
Entry
BSU30430          CDS       T00010                                 

Symbol
ytrD
Name
(RefSeq) ABC transporter permease
  KO
K16919  acetoin utilization transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU30430 (ytrD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU30430 (ytrD)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Acetoin utilization transporter
    BSU30430 (ytrD)
SSDB
Motif
Pfam: ABC2_membrane_2 CRPA
Other DBs
NCBI-GeneID: 936438
NCBI-ProteinID: NP_390921
Pasteur: BG13914
BSORF: BG13914
UniProt: O34953 A0A6M4JLB7
Position
complement(3115989..3116966)
AA seq 325 aa
MPDSGLLYKEWRQNKVALVITILVFILGNPLSILNMYLIYQGCVTGKENWVGPCVFSVDY
LNSSFISLFWIWGVVLAVSQLGIERSKSFFDFTLSLPYTRGQIFHAKFLTGGMVIVVPQL
IGYVLSVLLIMLLKPDQAVYFHNYSLGMIIVSMLAYSLVMAGGALTGNSFAQLLVSFTVA
ISPFLLISLPVINLEILFGGSIDFIHGPVPKWVQYFIPIIYVDSKWAENSPYYLVIPAIM
TIIFYIIGYISFVKMSNERNGYFFLWKPLNRPVQIIVIIIGIMGFGYFGFTASESFAGYL
IGMGTGAVIGFLISYFAIYKKMKLL
NT seq 978 nt   +upstreamnt  +downstreamnt
ttgccggattccggactgctttacaaagagtggcggcagaataaagtcgccttagttatc
accattttggtttttatattaggtaatccattatcaattttaaatatgtatctcatctat
caaggctgtgtcactggaaaagaaaattgggtcggcccctgcgtattcagcgttgattat
ttaaatagctcatttatctcattgttttggatttggggagtcgttttggcggtcagccag
cttgggattgaacgtagcaagagcttctttgattttacattaagccttccatatacacga
gggcagatatttcatgcgaagttccttaccggcggaatggtgattgtggtgccgcagctc
ataggttatgttttgtctgttttgctgatcatgcttttgaagccagatcaggccgtttat
tttcacaattacagcttgggaatgattattgttagcatgctggcttattctttggttatg
gccggaggagctttgacaggcaatagtttcgcacagcttctagtctcatttaccgtggcc
atttcgccgtttttactcatcagcctgcctgtgatcaacctcgagatcctttttggcgga
tcaatagattttatccatggtccagtacctaaatgggtgcagtatttcattccgataatt
tatgtagactcgaaatgggctgagaattcaccatattatttagtcattccggctatcatg
actatcattttttacatcatcggctatattagctttgttaaaatgtctaatgaaagaaac
ggatatttcttcttatggaagccgcttaaccgcccggtgcagatcatcgttattatcata
ggaatcatgggcttcggctattttggatttactgcaagcgagagctttgccggttatctc
attggcatgggtacaggtgcggtaatcggtttcttgattagttattttgcgatttataaa
aaaatgaaacttttgtaa

DBGET integrated database retrieval system