KEGG   Bacillus subtilis subsp. subtilis 168: BSU30440
Entry
BSU30440          CDS       T00010                                 

Symbol
ytrC
Name
(RefSeq) ABC transporter permease
  KO
K16919  acetoin utilization transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU30440 (ytrC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU30440 (ytrC)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Acetoin utilization transporter
    BSU30440 (ytrC)
SSDB
Motif
Pfam: ABC2_membrane_2 ABC2_membrane_4 ABC2_membrane_5 Gly-zipper_Omp
Other DBs
NCBI-GeneID: 937243
NCBI-ProteinID: NP_390922
Pasteur: BG13913
BSORF: BG13913
UniProt: O34898 A0A6M4JME1
Position
complement(3116996..3117982)
AA seq 328 aa
MVDRGLLYREWKQNQVVILLSIAFLVLANPLSIVNTYLSYQGCLDRQDPQYCDFIVNYSI
SNLIDINWVPGVILAVCFLGMERSKGTMDFILSLPYNRSQIFQTKFWLGGFVIVLSQLIG
FLLAWLLILVYNPEHVYFFEHSSIGVIVISFMAFSLVMAAGALTGNAFAQLLTAFSAAIL
PYLIIALPVGNLEVVFGANIWEIFPSPESYFSLASNLSNLVPISYVVNEWLINSKYLLLI
PAVMSMLFYLIGFISFKKLPSERNGHFFLWNRLDRPVQILVMAFGILGFGLFGYYTGHSI
IGYILGMIIGAVAGFFVSYFSIYKKTKV
NT seq 987 nt   +upstreamnt  +downstreamnt
atggtagaccgaggtctcctctatcgagagtggaagcagaatcaagtggtgattttgtta
agtatcgcgtttttagtattggcaaatccgctttctatcgttaatacgtatttgtcttat
caagggtgtcttgatcgccaagacccgcaatattgtgattttattgtgaattattccata
agcaatctgatagatatcaactgggtgccgggtgtcattttggcggtctgcttcctcgga
atggagcgttcgaaaggcacgatggattttatattaagcctcccgtataacagaagccaa
atttttcagacaaaattttggttaggcggttttgtgattgtgctgtcacaattgattggc
tttttacttgcatggctgctgattcttgtctataaccctgaacacgtctacttttttgag
cacagcagcattggagtaatcgtgataagttttatggctttttcactggtgatggccgcc
ggagcgttaactggaaatgcttttgcccaactgttaacggcgttttcagcagctatattg
ccgtatttaattattgcattgccggttggaaacctagaagttgtttttggtgcgaatata
tgggaaatattcccttcccctgagagttatttctctctggcaagcaatttatcgaaccta
gtaccgattagttacgttgtaaatgaatggctgattaacagtaaatatcttttattgatt
ccagccgtaatgagcatgctattttacttgattggctttataagcttcaagaagcttcca
agtgaacggaacggacactttttcttatggaacagattagatcgcccggtgcaaattctg
gttatggctttcggcatccttggatttggtttatttggatactataccggacattccatt
attggttatattttgggtatgatcattggagcagtggctggattctttgtgagctacttc
tctatttataagaaaacaaaagtgtaa

DBGET integrated database retrieval system