KEGG   Bacillus subtilis subsp. subtilis 168: BSU30460
Entry
BSU30460          CDS       T00010                                 

Symbol
ytrA
Name
(RefSeq) GntR family transcriptional regulator
  KO
K07979  GntR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU30460 (ytrA)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   GntR family
    BSU30460 (ytrA)
SSDB
Motif
Pfam: GntR HTH_Crp_2 Rrf2 HTH_24 HTH_36 LexA_DNA_bind Fe_dep_repress MarR HTH_41 AbiEi_4
Other DBs
NCBI-GeneID: 937244
NCBI-ProteinID: NP_390924
Pasteur: BG13911
BSORF: BG13911
UniProt: O34712 A0A6M3ZFR3
Position
complement(3118847..3119239)
AA seq 130 aa
MIQIDPRSSTPIYEQIIQQMKELCLKGIMKPGDKLPSVRELATIIIANPNTVSKAYKELE
REGIIETLRGRGTYISENAKTTLVEGKMTMIKEQLKQLIIDAHYAGVELEKLHEWIKEIS
ADVKGGKKND
NT seq 393 nt   +upstreamnt  +downstreamnt
atgattcaaatcgatccaagaagctcaacacccatttacgaacaaattattcagcaaatg
aaagagctttgtttgaaagggatcatgaagcctggtgataagcttccttctgtcagagaa
ttggcaacgatcattattgcgaatccgaacactgtcagcaaagcgtataaagaacttgag
cgagaggggattattgaaacgctgcggggcagagggacctatatatcggagaatgcaaaa
acgacactggttgaagggaagatgacgatgattaaagagcaactcaaacagctcatcatc
gatgcacactatgcaggggttgagctggaaaaactgcacgaatggataaaggaaatcagc
gctgatgtgaagggaggcaaaaaaaatgattga

DBGET integrated database retrieval system