KEGG   Bacillus subtilis subsp. subtilis 168: BSU30460Help
Entry
BSU30460          CDS       T00010                                 

Gene name
ytrA
Definition
(RefSeq) GntR family transcriptional regulator
  KO
K07979  GntR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU30460 (ytrA)
Transcription factors [BR:bsu03000]
 Prokaryotic Type
  Helix-turn-helix
   GntR family
    BSU30460 (ytrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GntR HTH_Crp_2 Rrf2 HTH_24 HTH_36 LexA_DNA_bind MarR Fe_dep_repress HTH_41 AbiEi_4
Motif
Other DBs
NCBI-GeneID: 937244
NCBI-ProteinID: NP_390924
Pasteur: BG13911
BSORF: BG13911
UniProt: O34712
Position
complement(3118847..3119239)
Genome map
AA seq 130 aa AA seqDB search
MIQIDPRSSTPIYEQIIQQMKELCLKGIMKPGDKLPSVRELATIIIANPNTVSKAYKELE
REGIIETLRGRGTYISENAKTTLVEGKMTMIKEQLKQLIIDAHYAGVELEKLHEWIKEIS
ADVKGGKKND
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgattcaaatcgatccaagaagctcaacacccatttacgaacaaattattcagcaaatg
aaagagctttgtttgaaagggatcatgaagcctggtgataagcttccttctgtcagagaa
ttggcaacgatcattattgcgaatccgaacactgtcagcaaagcgtataaagaacttgag
cgagaggggattattgaaacgctgcggggcagagggacctatatatcggagaatgcaaaa
acgacactggttgaagggaagatgacgatgattaaagagcaactcaaacagctcatcatc
gatgcacactatgcaggggttgagctggaaaaactgcacgaatggataaaggaaatcagc
gctgatgtgaagggaggcaaaaaaaatgattga

DBGET integrated database retrieval system