KEGG   Bacillus subtilis subsp. subtilis 168: BSU30470
Entry
BSU30470          CDS       T00010                                 

Symbol
ytzC
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF2524 DUF2564 PMEI ATP-synt_DE Rep_fac-A_C EloA-BP1
Other DBs
NCBI-GeneID: 936521
NCBI-ProteinID: NP_390925
Pasteur: BG13937
BSORF: BG13937
UniProt: O32073 A0A6M4JN72
Position
complement(3119565..3119837)
AA seq 90 aa
MATRQSVDEHLQQCMQAYDYAEEQLKIASKQEHYNDQEYSDAQMQLEDAVNALNKLWLSS
NDQQREQLYRMRLQLQSLQNNMILQHPLDV
NT seq 273 nt   +upstreamnt  +downstreamnt
gtggcaacaagacaatcagtagatgaacatctccagcaatgtatgcaggcctatgattat
gctgaagaacagctgaaaatcgcttctaaacaagagcattataacgatcaagaatatagt
gatgcacaaatgcagctagaagatgcggtaaatgccttgaataaactatggctgtcgtca
aatgatcagcagagagaacagctgtacagaatgagacttcagcttcaatctttgcaaaat
aatatgatcctgcagcaccctcttgatgtgtag

DBGET integrated database retrieval system