KEGG   Bacillus subtilis subsp. subtilis 168: BSU30470Help
Entry
BSU30470          CDS       T00010                                 

Gene name
ytzC
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2524 DUF2564 ATP-synt_DE PMEI Rep_fac-A_C YflT KELK
Motif
Other DBs
NCBI-GeneID: 936521
NCBI-ProteinID: NP_390925
Pasteur: BG13937
BSORF: BG13937
UniProt: O32073
Position
complement(3119565..3119837)
Genome map
AA seq 90 aa AA seqDB search
MATRQSVDEHLQQCMQAYDYAEEQLKIASKQEHYNDQEYSDAQMQLEDAVNALNKLWLSS
NDQQREQLYRMRLQLQSLQNNMILQHPLDV
NT seq 273 nt NT seq  +upstreamnt  +downstreamnt
gtggcaacaagacaatcagtagatgaacatctccagcaatgtatgcaggcctatgattat
gctgaagaacagctgaaaatcgcttctaaacaagagcattataacgatcaagaatatagt
gatgcacaaatgcagctagaagatgcggtaaatgccttgaataaactatggctgtcgtca
aatgatcagcagagagaacagctgtacagaatgagacttcagcttcaatctttgcaaaat
aatatgatcctgcagcaccctcttgatgtgtag

DBGET integrated database retrieval system