KEGG   Bacillus subtilis subsp. subtilis 168: BSU30480Help
Entry
BSU30480          CDS       T00010                                 

Gene name
ytqA
Definition
(RefSeq) radical SAM protein YtqA
  KO
K07139  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU30480 (ytqA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM_C Radical_SAM
Motif
Other DBs
NCBI-GeneID: 937240
NCBI-ProteinID: NP_390926
Pasteur: BG13908
BSORF: BG13908
UniProt: O35008
Position
3119999..3120967
Genome map
AA seq 322 aa AA seqDB search
MMQNNPFPYSNTEKRYHTLNYHLREHFGHKVFKVALDGGFDCPNRDGTVAHGGCTFCSAA
GSGDFAGNRTDDLITQFHDIKNRMHEKWKDGKYIAYFQAFTNTHAPVEVLREKFESVLAL
DDVVGISIATRPDCLPDDVVDYLAELNERTYLWVELGLQTVHERTALLINRAHDFNCYVE
GVNKLRKHGIRVCSHIINGLPLEDRDMMMETAKAVADLDVQGIKIHLLHLLKGTPMVKQY
EKGKLEFLSQDDYVQLVCDQLEIIPPEMIVHRITGDGPIELMIGPMWSVNKWEVLGAINK
ELENRGSYQGKFFQRLEEESAL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
gtgatgcagaacaatccttttccttattcaaatacggaaaaacgctatcatacattgaat
tatcatctcagagaacatttcggccataaggtgtttaaagtagcgcttgacggcggtttt
gactgtccaaatcgggatggcaccgtagcccacggaggctgtacgttttgcagcgcagca
ggctccggagattttgctggaaaccggaccgatgatttaattacgcaattccatgacatc
aaaaaccgcatgcacgaaaaatggaaggacggcaagtacatcgcttattttcaggctttc
acaaacactcacgccccggttgaggtgcttcgtgagaaattcgaatccgtcctcgcctta
gatgatgtggtcggcatttcgatcgccacacgcccggactgtctgcctgatgatgtcgtt
gattacttggcagagctgaatgaacgtacgtatttgtgggtggagcttgggcttcaaaca
gttcatgaacggactgcacttttgatcaaccgcgcacatgattttaactgctatgtggaa
ggcgtcaataaattaagaaaacacggcatacgtgtctgctcgcatattatcaacgggctg
cctttggaagaccgggacatgatgatggaaacggcaaaggccgtcgcagatttggatgtc
cagggcattaaaatccatctgcttcacctactgaaaggcacgccgatggtcaaacaatat
gaaaagggcaagctggaatttctttctcaagatgattatgtgcagctcgtctgcgatcag
cttgagatcattccgcctgaaatgatcgtccaccgcattacaggtgacggaccgattgag
ttgatgatcgggccaatgtggagcgtcaacaaatgggaagtgcttggcgccattaataaa
gagctagaaaatcgaggcagctatcaaggaaagttctttcaacggcttgaggaggaatca
gcgctatga

DBGET integrated database retrieval system