KEGG   Bacillus subtilis subsp. subtilis 168: BSU30490
Entry
BSU30490          CDS       T00010                                 

Symbol
ytqB
Name
(RefSeq) rRNA methylase YtqB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: rRNA_methylase Methyltransf_5 Methyltransf_31 Methyltransf_25 Methyltransf_32 Methyltr_RsmB-F VWA Ubie_methyltran Methyltransf_12 FtsJ Methyltransf_24 PCMT Methyltransf_23 Prok-JAB
Other DBs
NCBI-GeneID: 938058
NCBI-ProteinID: NP_390927
Pasteur: BG13909
BSORF: BG13909
UniProt: O34614
Structure
PDB: 
4PON 4POO

Position
3120964..3121548
AA seq 194 aa
MILKKILPYSKELLKMAAGEGDIVVDATMGNGHDTQFLAELVGENGHVYAFDIQESAVAN
TKERLGDMYQARTTLFHKSHDKIAESLPPETHGKVAAAVFNLGYLPGGDKSITTNGSSTI
KAIEQLLSIMKDEGLIVLVVYHGHPEGKAEKNDVLEFCRDLDQQTARVLTYGFINQQNDP
PFIVAIEKKAQISK
NT seq 585 nt   +upstreamnt  +downstreamnt
atgattttgaagaaaattcttccttacagcaaagaactgctgaaaatggccgcgggagag
ggagatattgtcgtagatgcgacaatgggcaacggacatgatacacagtttttagcggag
cttgtcggtgaaaacggccatgtatacgcattcgacatccaagaatcagccgtggccaat
acaaaggaacggctcggtgacatgtatcaagcgcgaacaacgttatttcacaaaagccat
gataaaatcgctgaatccctcccgcctgaaacacatggcaaagtggcggccgcggtattt
aacctcggctatttgccgggcggggacaaatcaattacgacaaacggcagttctacgatc
aaagccattgaacagcttctcagcatcatgaaagacgaaggtctgattgttctcgtcgtc
tatcatggccacccggaaggcaaagctgaaaaaaacgacgtgctcgagttttgccgggac
ttggaccagcaaacagcccgtgtattaacatacgggtttatcaatcagcaaaatgacccg
ccatttattgtcgccatcgaaaaaaaagctcagatcagcaaatga

DBGET integrated database retrieval system