KEGG   Bacillus subtilis subsp. subtilis 168: BSU30500
Entry
BSU30500          CDS       T00010                                 

Symbol
ytpB
Name
(RefSeq) tetraprenyl-beta-curcumene synthase
  KO
K16188  tetraprenyl-beta-curcumene synthase [EC:4.2.3.130]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU30500 (ytpB)
Enzymes [BR:bsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.130  tetraprenyl-beta-curcumene synthase
     BSU30500 (ytpB)
SSDB
Motif
Pfam: DUF2600
Other DBs
NCBI-GeneID: 936222
NCBI-ProteinID: NP_390928
Pasteur: BG13901
BSORF: BG13901
UniProt: O34707 A0A6M3ZFP9
Position
complement(3121538..3122641)
AA seq 367 aa
MTVPEHPFGLMAKVYRDIFPLVHQELDIWKQKSESIHNSELKAQATASIRDKTFHCEGGG
ILALLSGSQKQKCVEFIIAYQTISDYLDNLCDRSTSLDPQDFRMLHASMQDALTVGAELQ
NYYQFREEQDDSGYLHELVKTCQRVLGSIEHYDMIKPYLLELCGYYCDLQVHKHVIEHER
VPRLEKWFTQYESELPEMEWYEFSACAGSTLGIFCLVAYSFQPDFTESTAKKIRDSYFPY
IQGLHILLDYLIDQEEDLLEGDLNFCSYYQSHEEMMDRLEHFIHKADEHLQGIPHENFHR
LINRGLLGVYLSDDKVAGQKEMGRLAKKLIKASGKTSLFFYINGRAYRKFQKMSWMKNSK
KKAQIIC
NT seq 1104 nt   +upstreamnt  +downstreamnt
ttgacagtaccggaacatccttttggattgatggcaaaggtatatcgagatatttttccg
ctcgttcatcaagagctggacatatggaagcaaaaatcagaatcgattcataacagtgaa
ttgaaagcacaggcaaccgcaagtattcgggacaaaacgtttcactgtgaaggcggcggc
atactggccttattgtcaggcagccaaaagcagaaatgtgtcgagtttatcatcgcgtat
caaacgattagtgattatttggacaatctgtgtgaccgcagcacctcgctggacccgcag
gattttcggatgctccatgcctcaatgcaggacgcactgacagttggggcggaactgcaa
aactattatcaattcagggaagaacaggatgacagcggatatttgcatgaactggttaaa
acgtgccagcgtgttctcggctccattgagcactatgacatgattaaaccttatctgctt
gaactgtgcggctattattgcgatttgcaggtgcataagcacgttattgagcatgagcgt
gttccgcggcttgaaaagtggtttactcaatatgaatcagagctgcctgagatggaatgg
tatgaattttcagcctgtgcaggctcaacgttaggcattttctgtctggttgcgtattcg
ttccagcctgatttcacagaaagcaccgctaaaaaaatccgagacagttattttccttac
atacagggtcttcatattcttcttgattatttgattgatcaagaggaggacttgctggaa
ggagacttgaatttctgctcgtattatcagtctcatgaagagatgatggaccggcttgaa
cactttatccataaagccgacgagcatttacaaggcattccgcatgaaaacttccatcgt
ttaatcaatcgcggcttgcttggcgtttatttgtcagatgataaagtggcaggccaaaag
gaaatgggccggctcgcaaagaagctgatcaaagccagcggaaaaacctcccttttcttt
tatatcaacggcagagcctaccggaaatttcaaaaaatgtcctggatgaaaaattcaaag
aaaaaagctcaaatcatttgctga

DBGET integrated database retrieval system