KEGG   Bacillus subtilis subsp. subtilis 168: BSU30520Help
Entry
BSU30520          CDS       T00010                                 

Gene name
ytoA
Definition
(RefSeq) transferase YtoA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep Hexapep_2
Motif
Other DBs
NCBI-GeneID: 937238
NCBI-ProteinID: NP_390930
Pasteur: BG13896
BSORF: BG13896
UniProt: O34696
Position
3123490..3124005
Genome map
AA seq 171 aa AA seqDB search
MIYPYKEHKPDIHPTAFIADNATITGDVVIGEQSSIWFSVVIRGDVAPTRIGNRVNIQDL
SCLHQSPNKTLLIEDDATIGHQVTLHSAVIRKNALIGMGSIILDGAEIGEGAFIGAGSLV
PPGKIIPPGHLAFGRPAKVIRPLTEEDRKDMQRIRSEYVEKGQYYKFLQQT
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgatctacccttataaggaacacaagccagatatccacccaacagcctttatagctgat
aatgcaacaattaccggtgatgtcgtgatcggagaacagtccagcatttggttttctgtt
gtcataaggggagatgttgcgccgaccagaatcggaaacagagtcaatatccaagattta
agctgcctccatcaaagcccgaacaagacgctactcattgaagatgacgccacgataggc
catcaggttacacttcatagcgctgttatccgcaagaacgccttaatcgggatgggctca
atcattttagacggagccgaaattggcgaaggcgcttttattggtgccggcagtcttgtc
ccgcccggaaaaatcattccgcctggccatctcgcctttggccgccctgcaaaagtcatc
cgccctttgacggaagaagaccgaaaagatatgcaaagaatacggtcagaatatgtagaa
aagggccaatattataaatttcttcaacaaacataa

DBGET integrated database retrieval system