KEGG   Bacillus subtilis subsp. subtilis 168: BSU30530
Entry
BSU30530          CDS       T00010                                 

Gene name
ytnA
Definition
(RefSeq) amino acid permease YtnA
  KO
K03293  amino acid transporter, AAT family
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BSU30530 (ytnA)
SSDB
Motif
Pfam: AA_permease AA_permease_2
Other DBs
NCBI-GeneID: 938118
NCBI-ProteinID: NP_390931
Pasteur: BG13891
BSORF: BG13891
UniProt: O34618
Position
complement(3124250..3125641)
AA seq 463 aa
MQKQKQELHRGLEERHISLMSLGAAIGVGLFLGSASAIQLAGPGILVAYAASGLVMFFIM
RALGEMAIQKPVAGSFSRYARDYLGPLAGYLTGWNYWFLWVVTCMAEITAVGIYMGFWFP
DVPNWIWALSALVIMTGVNFLAVKAYGELEFWFALIKIVAILSMIAVGLLMIIAGVGNGG
IATGISNLWNNGGFFPHGLKGVLLSLQMVMFAYLGIEMIGVTAGEVKNPQKSLAKAIDTV
FWRILIFYVGALFVIMSIYPWQEIGSQGSPFVLTFQKVGIPSAAGIINFVVLTAALSSCN
SGIFSTGRMLFNLAEQKEAPQAYGQLTKGGIPGKAVLASAGALLVGVLLNYVVPAKVFTW
VTSIATFGAIWTWAIILLSQIKYRKSLKPEEKKQLKYKMPLFPFTSYVSLAFLAFVVILM
AYSPDTRVAVIIGPIWFLILLAVYYGKGFHKKNAAAASERNIS
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgcaaaaacaaaaacaagagctgcaccgcggactcgaagaaaggcatatttctttaatg
tctttaggagctgctataggagtagggttgttcctcggctccgcatcagctattcaatta
gcagggcctggtattttggtagcgtatgccgcaagcggcctggtcatgttttttattatg
agagcgcttggggaaatggccattcaaaaaccggtcgcaggctccttcagcaggtatgcg
cgtgattatttgggaccgcttgcaggctatttaacaggttggaactactggtttttatgg
gttgtcacctgtatggccgaaatcactgctgtcggcatctatatggggttctggtttccg
gacgtgccaaactggatttgggcgttatcggcactggtcattatgacgggtgttaatttc
ctggctgtcaaagcttacggcgagctggaattttggttcgcattgattaaaattgttgca
atcttatccatgattgctgtcggtttattgatgattattgcaggagtcggcaatgggggc
attgcaaccggaatcagcaatttgtggaacaacggaggatttttccctcatggattaaaa
ggggttttattgtctcttcaaatggtcatgttcgcctatttagggattgaaatgatcggg
gtgacggctggcgaagtaaaaaacccgcaaaaatcgttagccaaagcaatcgatacagta
ttttggcggattttgattttttatgtaggcgctttatttgtcattatgtctatttatccg
tggcaggaaattggctctcaaggaagtccatttgttctcacatttcaaaaagtgggcatt
ccatcggccgcaggtatcattaactttgtcgtgttgacagccgcgctgtcttcatgcaac
agtggtattttcagcacagggcggatgctgtttaacttggcggaacagaaagaggcgcca
caagcatatggtcagctgacgaaaggcggcatcccgggtaaagctgttctggcttcagcg
ggcgctttattagtcggagtgctgttaaactatgttgtccctgcgaaggtatttacttgg
gttacaagtattgcgacgttcggagcgatttggacgtgggcaatcattttgctttctcaa
ataaaatacaggaaaagtttgaagccggaagaaaagaaacaattaaagtacaaaatgcct
ttatttccgtttacgtcttatgtgtcattggcatttctagcattcgtcgtcattcttatg
gcttacagccctgatacaagagtagccgtgattatcgggccgatatggtttctcatcttg
ctggctgtgtactatggaaaagggtttcataaaaaaaatgcggctgctgccagcgaacga
aatatcagctga

DBGET integrated database retrieval system