KEGG   Bacillus subtilis subsp. subtilis 168: BSU30540
Entry
BSU30540          CDS       T00010                                 

Symbol
asnB
Name
(RefSeq) asparagine synthetase 1
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00250  Alanine, aspartate and glutamate metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BSU30540 (asnB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU30540 (asnB)
Enzymes [BR:bsu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     BSU30540 (asnB)
Peptidases and inhibitors [BR:bsu01002]
 Cysteine peptidases
  Family C44
   BSU30540 (asnB)
SSDB
Motif
Pfam: Asn_synthase GATase_7 GATase_6 QueC DUF3700 NAD_synthase
Other DBs
NCBI-GeneID: 937236
NCBI-ProteinID: NP_390932
Pasteur: BG11831
BSORF: BG11831
UniProt: P54420
Position
complement(3125777..3127675)
AA seq 632 aa
MCGFVGVFNKHPLAQTADQEELIKQMNQMIVHRGPDSDGYFHDEHVGFGFRRLSIIDVEN
GGQPLSYEDETYWIIFNGEIYNYIELREELEAKGYTFNTDSDTEVLLATYRHYKEEAASK
LRGMFAFLIWNKNDHVLYGARDPFGIKPLYYTTINDQVYFASERKSLMVAQNDIEIDKEA
LQQYMSFQFVPEPSTLDAHVKKVEPGSQFTIRPDGDITFKTYFKANFKPVQTEEDKLVKE
VRDAIYDSVNVHMRSDVPVGSFLSGGIDSSFIVSVAKEFHPSLKTFSVGFEQQGFSEVDV
AKETAAALGIENISKVISPEEYMNELPKIVWHFDDPLADPAAIPLYFVAKEAKKHVTVAL
SGEGADELFGGYNIYREPLSLKPFERIPSGLKKMLLHVAAVMPEGMRGKSLLERGCTPLQ
DRYIGNAKIFEESVKKQLLKHYNPNLSYRDVTKTYFTESSSYSDINKMQYVDIHTWMRGD
ILLKADKMTMANSLELRVPFLDKVVFDVASKIPDELKTKNGTTKYLLRKAAEGIVPEHVL
NRKKLGFPVPIRHWLKNEMNEWVRNIIQESQTDAYIHKDYVLQLLEDHCADKADNSRKIW
TVLIFMIWHSINIEKRYMPEELSHQPKEVIFV
NT seq 1899 nt   +upstreamnt  +downstreamnt
atgtgtggatttgtcggggtttttaacaagcatccgttagctcaaaccgctgatcaagaa
gaactaatcaaacaaatgaaccaaatgatcgttcaccgcggtcctgacagtgatggatat
ttccatgatgagcacgtcggcttcggattcagacggctcagcattattgatgtagaaaat
ggtggacagcctttatcatatgaagatgaaacatattggattatctttaacggagaaatc
tataactatatcgaactgagagaagaacttgaagcaaaggggtacacattcaacacggat
tcggacacagaggttcttcttgcgacttaccgtcactataaagaagaagcggcgtccaaa
ctgcgcggtatgtttgcctttctgatttggaataaaaacgatcatgtgctttatggggca
agagatccattcggcattaaaccgttgtactacacaacgatcaatgatcaggtttatttt
gcctcagagagaaaaagtttaatggttgctcagaatgatattgaaatagataaagaggca
ttgcagcagtacatgtctttccaatttgttcctgaaccaagcacgcttgatgcccatgtg
aaaaaagtagagccgggttcacaattcacaatccgcccggacggcgatatcacattcaaa
acgtatttcaaagcgaacttcaagccggttcagactgaagaagacaagcttgtgaaagaa
gtccgagacgcgatctatgactctgtaaacgttcatatgagaagtgacgttcctgtcggt
tcgttcctgtctggcgggattgattcttcctttattgtgtctgttgcgaaggaatttcat
ccaagcttaaaaacattctctgtcggctttgaacagcagggcttcagtgaggttgatgta
gcgaaagaaacggcagcggcgctgggcattgaaaatatcagcaaagtcatttcgcctgag
gaatacatgaatgagcttccgaagatcgtatggcattttgatgacccgcttgctgatccg
gcagcgattccgttgtactttgttgcaaaagaagcaaaaaaacatgttacggttgcttta
tcaggtgaaggagcggatgagctcttcggcggatataacatttaccgtgaaccgctttcg
cttaaaccgtttgaacggattccgtccggcttgaaaaagatgcttctgcacgttgctgcc
gttatgcctgaaggtatgagagggaagagcctgcttgagcgcggctgcactccgcttcag
gatcgttatatcggtaacgcgaaaatctttgaagagtctgtcaaaaagcagctgttgaag
cattataatccgaacctttcatatcgcgatgtgacgaagacttactttacagaaagcagc
tcgtacagcgatatcaacaaaatgcagtatgtcgatatccacacttggatgcgcggcgac
attttgttaaaggcggataaaatgacgatggcgaattctttggaactgcgtgtgccgttc
ttggataaagtcgtattcgacgtcgcttcaaaaattcctgatgagctgaaaacgaagaac
ggcacgacgaagtatcttcttcgcaaagccgctgaaggaattgtgcctgagcacgtatta
aaccgcaaaaagcttggtttccctgtaccgatccgtcattggctgaaaaacgaaatgaac
gaatgggtgcggaatattattcaagaaagccaaacggatgcttatatccataaggattat
gtccttcagcttcttgaagaccattgtgcggacaaggctgataacagccgtaaaatttgg
actgtgctaatctttatgatctggcacagcatcaatattgaaaaacggtatatgcctgaa
gagctgagccatcagcctaaagaagtcatctttgtgtaa

DBGET integrated database retrieval system