KEGG   Bacillus subtilis subsp. subtilis 168: BSU30550
Entry
BSU30550          CDS       T00010                                 

Symbol
metK
Name
(RefSeq) S-adenosylmethionine synthase
  KO
K00789  S-adenosylmethionine synthetase [EC:2.5.1.6]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00270  Cysteine and methionine metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01230  Biosynthesis of amino acids
bsu01240  Biosynthesis of cofactors
Module
bsu_M00034  Methionine salvage pathway
bsu_M00609  Cysteine biosynthesis, methionine => cysteine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BSU30550 (metK)
Enzymes [BR:bsu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.6  methionine adenosyltransferase
     BSU30550 (metK)
SSDB
Motif
Pfam: S-AdoMet_synt_C S-AdoMet_synt_M S-AdoMet_synt_N
Other DBs
NCBI-GeneID: 937090
NCBI-ProteinID: NP_390933
Pasteur: BG11840
BSORF: BG11840
UniProt: P54419 A0A6M4JMM6
Position
complement(3127825..3129027)
AA seq 400 aa
MSKNRRLFTSESVTEGHPDKICDQISDSILDEILKKDPNARVACETSVTTGLVLVSGEIT
TSTYVDIPKTVRQTIKEIGYTRAKYGFDAETCAVLTSIDEQSADIAMGVDQALEAREGTM
SDEEIEAIGAGDQGLMFGYACNETKELMPLPISLAHKLARRLSEVRKEDILPYLRPDGKT
QVTVEYDENNKPVRIDAIVISTQHHPEITLEQIQRNIKEHVINPVVPEELIDEETKYFIN
PTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSAAYAARYVAKNI
VAAELADSCEVQLAYAIGVAQPVSISINTFGSGKASEEKLIEVVRNNFDLRPAGIIKMLD
LRRPIYKQTAAYGHFGRHDVDLPWERTDKAEQLRKEALGE
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgagtaaaaatcgtcgtttatttacatcagaatctgttacggaggggcatccggataaa
atctgtgaccagatttctgacagcattttagatgaaattttaaagaaagaccctaacgcg
cgtgttgcttgtgaaacatctgtgacaacaggtttggttcttgtaagcggagagatcaca
acttctacgtatgttgacattccgaaaacggttcgccaaaccattaaagaaatcggatac
acacgtgcaaaatacggatttgatgcggaaacttgtgcggttttaacatcaattgatgag
cagtctgctgatatcgcgatgggcgtagaccaagcgcttgaagcccgtgaaggcacaatg
agcgacgaagaaattgaagcgattggtgcgggtgaccaaggattaatgttcggttatgcg
tgcaacgaaacgaaagagcttatgcctcttccaatttcacttgcccataaattagcccgc
cgcctaagtgaagtccgtaaagaagatattcttccgtaccttcgccctgacggcaaaaca
caggtaacggttgagtacgatgaaaataacaaaccagtccgcattgacgcgattgttatt
tcaactcagcatcaccctgaaattacacttgagcaaattcagcgcaacattaaagaacat
gtaatcaatccggttgttcctgaagagctgattgatgaagaaacaaaatatttcatcaac
cctacaggacgtttcgtaatcggaggccctcaaggggatgcgggacttacaggacgcaaa
atcatcgttgatacgtacggcggctatgcacgccacggcggaggcgcgttctcaggtaag
gacgcgacgaaggtagaccgttctgcagcttatgcggcaagatacgttgcgaaaaacatc
gttgcggctgagcttgctgattcttgcgaagtacagcttgcttacgcgatcggtgttgca
cagcctgtgtcaatctcaatcaacacattcggttcaggaaaagcttctgaggaaaaactg
attgaagttgttcgcaataactttgatttacgacctgccggcattatcaaaatgcttgat
ttgcgccgtccgatctataaacaaactgctgcgtacggccactttggacgtcacgatgtt
gaccttccatgggagcgcacagacaaagcggagcagctgcgtaaagaagcgttaggagaa
taa

DBGET integrated database retrieval system