KEGG   Bacillus subtilis subsp. subtilis 168: BSU30560Help
Entry
BSU30560          CDS       T00010                                 

Gene name
pckA
Definition
(RefSeq) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00010  Glycolysis / Gluconeogenesis
bsu00020  Citrate cycle (TCA cycle)
bsu00620  Pyruvate metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01130  Biosynthesis of antibiotics
bsu01200  Carbon metabolism
Module
bsu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSU30560 (pckA)
   00020 Citrate cycle (TCA cycle)
    BSU30560 (pckA)
   00620 Pyruvate metabolism
    BSU30560 (pckA)
Enzymes [BR:bsu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     BSU30560 (pckA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_16 AAA_24 AAA_33
Motif
Other DBs
NCBI-GeneID: 937235
NCBI-ProteinID: NP_390934
Pasteur: BG11841
BSORF: BG11841
UniProt: P54418
Position
3129530..3131113
Genome map
AA seq 527 aa AA seqDB search
MNSVDLTADLQALLTCPNVRHNLSAAQLTEKVLSRNEGILTSTGAVRATTGAYTGRSPKD
KFIVEEESTKNKIDWGPVNQPISEEAFERLYTKVVSYLKERDELFVFEGFAGADEKYRLP
ITVVNEFAWHNLFARQLFIRPEGNDKKTVEQPFTILSAPHFKADPKTDGTHSETFIIVSF
EKRTILIGGTEYAGEMKKSIFSIMNFLLPERDILSMHCSANVGEKGDVALFFGLSGTGKT
TLSADADRKLIGDDEHGWSDTGVFNIEGGCYAKCIHLSEEKEPQIFNAIRFGSVLENVVV
DEDTREANYDDSFYTENTRAAYPIHMINNIVTPSMAGHPSAIVFLTADAFGVLPPISKLT
KEQAMYHFLSGYTSKLAGTERGVTSPETTFSTCFGSPFLPLPAHVYAEMLGKKIDEHGAD
VFLVNTGWTGGGYGTGERMKLSYTRAMVKAAIEGKLEDAEMITDDIFGLHIPAHVPGVPD
HILQPENTWTNKEEYKEKAVYLANEFKENFKKFAHTDAIAQAGGPLV
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgaactcagttgatttgaccgctgatttacaagccttattaacatgtccaaatgtgcgt
cataatttatcagcagcacagctaacagaaaaagtcctctcccgaaacgaaggcatttta
acatccacaggtgctgttcgcgcgacaacaggcgcttacacaggacgctcacctaaagat
aaattcatcgtggaggaagaaagcacgaaaaataagatcgattggggcccggtgaatcag
ccgatttcagaagaagcgtttgagcggctgtacacgaaagttgtcagctatttaaaggag
cgagatgaactgtttgttttcgaaggatttgccggagcagacgagaaatacaggctgccg
atcactgtcgtaaatgagttcgcatggcacaatttatttgcgcggcagctgtttatccgt
ccggaaggaaatgataagaaaacagttgagcagccgttcaccattctttctgctccgcat
ttcaaagcggatccaaaaacagacggcactcattccgaaacgtttattattgtctctttc
gaaaagcggacaattttaatcggcggaactgagtatgccggtgaaatgaagaagtccatt
ttctccattatgaatttcctgctgcctgaaagagatattttatctatgcactgctccgcc
aatgtcggtgaaaaaggcgatgtcgcccttttcttcggactgtcaggaacaggaaagacc
accctgtcggcagatgctgaccgcaagctgatcggtgacgatgaacatggctggtctgat
acaggcgtctttaatattgaaggcggatgctacgctaagtgtattcatttaagcgaggaa
aaggagccgcaaatctttaacgcgatccgcttcgggtctgttctcgaaaatgtcgttgtg
gatgaagatacacgcgaagccaattatgatgattccttctatactgaaaacacgcgggca
gcttacccgattcatatgattaataacatcgtgactccaagcatggccggccatccgtca
gccattgtatttttgacggctgatgccttcggagtcctgccgccgatcagcaaactaacg
aaggagcaggcgatgtaccattttttgagcggttacacgagtaagcttgccggaaccgaa
cgtggtgtcacgtctcctgaaacgacgttttctacatgcttcggctcaccgttcctgccg
cttcctgctcacgtctatgctgaaatgctcggcaaaaagatcgatgaacacggcgcagac
gttttcttagtcaataccggatggaccgggggcggctacggcacaggcgaacgaatgaag
ctttcttacactagagcaatggtcaaagcagcgattgaaggcaaattagaggatgctgaa
atgataactgacgatattttcggcctgcacattccggcccatgttcctggcgttcctgat
catatccttcagcctgaaaacacgtggaccaacaaggaagaatacaaagaaaaagcagtc
taccttgcaaatgaattcaaagagaactttaaaaagttcgcacataccgatgccatcgcc
caggcaggcggccctctcgtataa

DBGET integrated database retrieval system