KEGG   Bacillus subtilis subsp. subtilis 168: BSU30560
Entry
BSU30560          CDS       T00010                                 

Symbol
pckA
Name
(RefSeq) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00010  Glycolysis / Gluconeogenesis
bsu00020  Citrate cycle (TCA cycle)
bsu00620  Pyruvate metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
Module
bsu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSU30560 (pckA)
   00020 Citrate cycle (TCA cycle)
    BSU30560 (pckA)
   00620 Pyruvate metabolism
    BSU30560 (pckA)
Enzymes [BR:bsu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     BSU30560 (pckA)
SSDB
Motif
Pfam: PEPCK_ATP AAA_16 AAA_24 AAA_33
Other DBs
NCBI-GeneID: 937235
NCBI-ProteinID: NP_390934
Pasteur: BG11841
BSORF: BG11841
UniProt: P54418 A0A6M3ZFS1
Position
3129530..3131113
AA seq 527 aa
MNSVDLTADLQALLTCPNVRHNLSAAQLTEKVLSRNEGILTSTGAVRATTGAYTGRSPKD
KFIVEEESTKNKIDWGPVNQPISEEAFERLYTKVVSYLKERDELFVFEGFAGADEKYRLP
ITVVNEFAWHNLFARQLFIRPEGNDKKTVEQPFTILSAPHFKADPKTDGTHSETFIIVSF
EKRTILIGGTEYAGEMKKSIFSIMNFLLPERDILSMHCSANVGEKGDVALFFGLSGTGKT
TLSADADRKLIGDDEHGWSDTGVFNIEGGCYAKCIHLSEEKEPQIFNAIRFGSVLENVVV
DEDTREANYDDSFYTENTRAAYPIHMINNIVTPSMAGHPSAIVFLTADAFGVLPPISKLT
KEQAMYHFLSGYTSKLAGTERGVTSPETTFSTCFGSPFLPLPAHVYAEMLGKKIDEHGAD
VFLVNTGWTGGGYGTGERMKLSYTRAMVKAAIEGKLEDAEMITDDIFGLHIPAHVPGVPD
HILQPENTWTNKEEYKEKAVYLANEFKENFKKFAHTDAIAQAGGPLV
NT seq 1584 nt   +upstreamnt  +downstreamnt
atgaactcagttgatttgaccgctgatttacaagccttattaacatgtccaaatgtgcgt
cataatttatcagcagcacagctaacagaaaaagtcctctcccgaaacgaaggcatttta
acatccacaggtgctgttcgcgcgacaacaggcgcttacacaggacgctcacctaaagat
aaattcatcgtggaggaagaaagcacgaaaaataagatcgattggggcccggtgaatcag
ccgatttcagaagaagcgtttgagcggctgtacacgaaagttgtcagctatttaaaggag
cgagatgaactgtttgttttcgaaggatttgccggagcagacgagaaatacaggctgccg
atcactgtcgtaaatgagttcgcatggcacaatttatttgcgcggcagctgtttatccgt
ccggaaggaaatgataagaaaacagttgagcagccgttcaccattctttctgctccgcat
ttcaaagcggatccaaaaacagacggcactcattccgaaacgtttattattgtctctttc
gaaaagcggacaattttaatcggcggaactgagtatgccggtgaaatgaagaagtccatt
ttctccattatgaatttcctgctgcctgaaagagatattttatctatgcactgctccgcc
aatgtcggtgaaaaaggcgatgtcgcccttttcttcggactgtcaggaacaggaaagacc
accctgtcggcagatgctgaccgcaagctgatcggtgacgatgaacatggctggtctgat
acaggcgtctttaatattgaaggcggatgctacgctaagtgtattcatttaagcgaggaa
aaggagccgcaaatctttaacgcgatccgcttcgggtctgttctcgaaaatgtcgttgtg
gatgaagatacacgcgaagccaattatgatgattccttctatactgaaaacacgcgggca
gcttacccgattcatatgattaataacatcgtgactccaagcatggccggccatccgtca
gccattgtatttttgacggctgatgccttcggagtcctgccgccgatcagcaaactaacg
aaggagcaggcgatgtaccattttttgagcggttacacgagtaagcttgccggaaccgaa
cgtggtgtcacgtctcctgaaacgacgttttctacatgcttcggctcaccgttcctgccg
cttcctgctcacgtctatgctgaaatgctcggcaaaaagatcgatgaacacggcgcagac
gttttcttagtcaataccggatggaccgggggcggctacggcacaggcgaacgaatgaag
ctttcttacactagagcaatggtcaaagcagcgattgaaggcaaattagaggatgctgaa
atgataactgacgatattttcggcctgcacattccggcccatgttcctggcgttcctgat
catatccttcagcctgaaaacacgtggaccaacaaggaagaatacaaagaaaaagcagtc
taccttgcaaatgaattcaaagagaactttaaaaagttcgcacataccgatgccatcgcc
caggcaggcggccctctcgtataa

DBGET integrated database retrieval system