KEGG   Bacillus subtilis subsp. subtilis 168: BSU30570
Entry
BSU30570          CDS       T00010                                 

Symbol
ytmB
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF2584 Ribophorin_II
Other DBs
NCBI-GeneID: 937228
NCBI-ProteinID: NP_390935
Pasteur: BG13882
BSORF: BG13882
UniProt: O34365 A0A6M3ZFA3
Structure
PDB: 
2NWA

Position
complement(3131152..3131394)
AA seq 80 aa
MGMPVEFNTLIVTKGKEVRIDENIFTLEKDGYRVYPMEIPMDVRKTKFGEKSGTAEVQKL
QWEEGRTIITYKLTSLHSVN
NT seq 243 nt   +upstreamnt  +downstreamnt
ttgggaatgcctgttgaatttaatacactgattgtgacaaaaggaaaagaagttcgcata
gatgaaaatatattcacgttagagaaggacggataccgagtatatccgatggagattcca
atggatgtacgcaaaacaaagtttggcgaaaagtcaggcacagctgaagtgcagaagctt
caatgggaagaaggccggaccatcattacatacaagctgacttctttgcattccgtcaat
taa

DBGET integrated database retrieval system