KEGG   Bacillus subtilis subsp. subtilis 168: BSU30595Help
Entry
BSU30595          CDS       T00010                                 

Gene name
ytlA
Definition
(RefSeq) ABC transporter substrate-binding protein YtlA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NMT1_2 NMT1 VitK2_biosynth Trypan_glycop
Motif
Other DBs
NCBI-GeneID: 935959
NCBI-ProteinID: NP_390937
UniProt: C0SP84
Position
3132370..3133374
Genome map
AA seq 334 aa AA seqDB search
MNRWLRLGFACVGSIFLMFALAACKQEETLTKVKVAEVTHSIFYAPLYVAESKGFFKEEG
LDVDVNTTWGGDKTMTSLLSNGSDIALVGSETSIYVEAQGAKDPVINFAQLTQTDGTFLV
AREDVEHFDWDQLKGKTFLGQRKGGMPQMVGEYVLNKHKIDPHKDIDLIQNIDFANIANA
FASGTGEYVQLFEPQASLFEKKGIGHIVASFGEESGEVPYTTFMAKQSYLKKNEDTAVKF
TKAIYKAQQWVENHSAKDITDAIKDEFDDTDPDVIETSIERYKKQHSYSPDPLLNEKEWE
LLQTIMDKSGELPKHIPYNQLVNKEIAEKVTSEK
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
gtgaacagatggttaaggctgggcttcgcctgtgtcggcagtatctttctgatgttcgcc
ctggcggcttgcaagcaggaagaaacgctcaccaaagtcaaagtagctgaagtgacccat
tcaattttttacgcacctttatatgttgctgagtctaaaggtttttttaaggaagaaggg
cttgatgtcgatgtgaatacgacctggggcggagataaaacgatgacatcgcttctttcc
aacggctccgacatcgcgcttgtcgggtcagaaacatctatttatgtcgaagcgcaaggg
gctaaagatcccgtcattaatttcgcccagctgactcagacagacggaacgtttcttgtc
gcgagagaagatgttgaacacttcgactgggatcagctgaaaggaaaaacgtttctcggt
cagcgaaaaggcggcatgccgcaaatggtcggcgagtatgtactgaacaaacataagatt
gacccgcataaggatatagacctcatccagaacatagacttcgccaatattgccaatgcg
tttgcttctggaaccggtgagtatgtacagctctttgaaccgcaggcttctctctttgag
aaaaaaggcatcggccatatcgtggcttcattcggagaagaatcaggagaggttccttat
acgacttttatggcgaaacaaagctatttgaagaaaaatgaagacacagccgtcaagttt
acaaaagccatttataaggcgcagcagtgggttgaaaatcattctgcgaaggacatcaca
gatgccattaaagatgaatttgatgataccgacccagacgtcatcgaaacatccattgaa
cgctataaaaaacagcattcatattcaccagaccctctgcttaacgaaaaagaatgggag
cttctccaaaccattatggataaatcgggagaactgccgaagcacattccatacaatcag
cttgtaaataaagaaattgctgaaaaagtcacctcggagaaatag

DBGET integrated database retrieval system