KEGG   Bacillus subtilis subsp. subtilis 168: BSU30595
Entry
BSU30595          CDS       T00010                                 

Symbol
ytlA
Name
(RefSeq) ABC transporter substrate-binding protein YtlA
  KO
K02051  NitT/TauT family transport system substrate-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU30595 (ytlA)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   NitT/TauT family transporter
    BSU30595 (ytlA)
SSDB
Motif
Pfam: NMT1_2 NMT1 Phosphonate-bd Trypan_glycop
Other DBs
NCBI-GeneID: 935959
NCBI-ProteinID: NP_390937
UniProt: C0SP84 A0A6M3ZFI4
Position
3132370..3133374
AA seq 334 aa
MNRWLRLGFACVGSIFLMFALAACKQEETLTKVKVAEVTHSIFYAPLYVAESKGFFKEEG
LDVDVNTTWGGDKTMTSLLSNGSDIALVGSETSIYVEAQGAKDPVINFAQLTQTDGTFLV
AREDVEHFDWDQLKGKTFLGQRKGGMPQMVGEYVLNKHKIDPHKDIDLIQNIDFANIANA
FASGTGEYVQLFEPQASLFEKKGIGHIVASFGEESGEVPYTTFMAKQSYLKKNEDTAVKF
TKAIYKAQQWVENHSAKDITDAIKDEFDDTDPDVIETSIERYKKQHSYSPDPLLNEKEWE
LLQTIMDKSGELPKHIPYNQLVNKEIAEKVTSEK
NT seq 1005 nt   +upstreamnt  +downstreamnt
gtgaacagatggttaaggctgggcttcgcctgtgtcggcagtatctttctgatgttcgcc
ctggcggcttgcaagcaggaagaaacgctcaccaaagtcaaagtagctgaagtgacccat
tcaattttttacgcacctttatatgttgctgagtctaaaggtttttttaaggaagaaggg
cttgatgtcgatgtgaatacgacctggggcggagataaaacgatgacatcgcttctttcc
aacggctccgacatcgcgcttgtcgggtcagaaacatctatttatgtcgaagcgcaaggg
gctaaagatcccgtcattaatttcgcccagctgactcagacagacggaacgtttcttgtc
gcgagagaagatgttgaacacttcgactgggatcagctgaaaggaaaaacgtttctcggt
cagcgaaaaggcggcatgccgcaaatggtcggcgagtatgtactgaacaaacataagatt
gacccgcataaggatatagacctcatccagaacatagacttcgccaatattgccaatgcg
tttgcttctggaaccggtgagtatgtacagctctttgaaccgcaggcttctctctttgag
aaaaaaggcatcggccatatcgtggcttcattcggagaagaatcaggagaggttccttat
acgacttttatggcgaaacaaagctatttgaagaaaaatgaagacacagccgtcaagttt
acaaaagccatttataaggcgcagcagtgggttgaaaatcattctgcgaaggacatcaca
gatgccattaaagatgaatttgatgataccgacccagacgtcatcgaaacatccattgaa
cgctataaaaaacagcattcatattcaccagaccctctgcttaacgaaaaagaatgggag
cttctccaaaccattatggataaatcgggagaactgccgaagcacattccatacaatcag
cttgtaaataaagaaattgctgaaaaagtcacctcggagaaatag

DBGET integrated database retrieval system