KEGG   Bacillus subtilis subsp. subtilis 168: BSU30610
Entry
BSU30610          CDS       T00010                                 

Symbol
ytlC
Name
(RefSeq) ABC transporter ATP-binding protein
  KO
K02049  NitT/TauT family transport system ATP-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU30610 (ytlC)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   NitT/TauT family transporter
    BSU30610 (ytlC)
SSDB
Motif
Pfam: ABC_tran AAA_21 AAA_16 AAA RsgA_GTPase Mg_chelatase AAA_29 Rad17 NB-ARC RuvB_N AAA_23 NACHT AAA_30 AAA_22 AAA_28 DO-GTPase2 RNA_helicase T2SSE CbiZ
Other DBs
NCBI-GeneID: 937218
NCBI-ProteinID: NP_390939
Pasteur: BG13875
BSORF: BG13875
UniProt: O34314 A0A6M3ZIQ2
Position
3133387..3134169
AA seq 260 aa
MSFLHVDHVTHTYFSIKEKTTAVRDIHFDAEKGDFISFLGPSGCGKTTLLSIIAGLIEPS
EGRVLIEGREPNQKEHNIGYMLQQDYLFPWKSIEENVLLGLKIADTLTEESKAAALGLLP
EFGLIDVEKKYPKELSGGMRQRAALARTLAPNPSLLLLDEPFSALDFQTKLSLENLVFRT
LKEYQKTAVLVTHDIGEAIAMSDTIFLFSNQPGTIHQIFTIPKELAAMLPFDARQEPSFQ
TLFQTIWKELNSLEKQQRNH
NT seq 783 nt   +upstreamnt  +downstreamnt
atgtctttcttacatgtcgaccatgtaacccatacttatttttctattaaagaaaaaaca
acggctgtgcgggatattcatttcgatgccgaaaaaggcgatttcatctcatttctcggc
ccaagcggctgcggaaaaacaacattgctttccattattgccggtttgattgagccatca
gaaggcagagttctgattgaaggccgtgagccgaatcaaaaagaacataatattggctat
atgcttcagcaggattacttatttccctggaaatctatcgaggaaaatgtgcttctcggt
ttaaaaatcgccgacacgctgacagaagaaagcaaagccgctgcactcggtctattgccg
gagttcggcctcatagatgtggagaaaaaatatccgaaagaactgtcaggcgggatgcgc
cagcgggctgcgcttgcaagaacacttgcgcctaaccctagtctgcttttgctggatgag
ccattttccgcgcttgattttcagacaaagctgtctttggaaaacctggtattccgcaca
ttaaaggaatatcaaaaaacagcagtgcttgtcactcatgatataggggaagcgatagcg
atgagcgatacgatctttttattttcaaatcagccgggcaccatccatcagatttttacc
attcctaaggaattggccgcgatgttgccttttgacgcccgtcaggaaccttccttccag
acactgtttcaaacgatatggaaggagctgaattctcttgagaaacagcaaagaaaccat
tga

DBGET integrated database retrieval system