KEGG   Bacillus subtilis subsp. subtilis 168: BSU30620
Entry
BSU30620          CDS       T00010                                 

Symbol
ytlD
Name
(RefSeq) ABC transporter permease
  KO
K02050  NitT/TauT family transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU30620 (ytlD)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   NitT/TauT family transporter
    BSU30620 (ytlD)
SSDB
Motif
Pfam: BPD_transp_1 DUF5887
Other DBs
NCBI-GeneID: 937097
NCBI-ProteinID: NP_390940
Pasteur: BG13876
BSORF: BG13876
UniProt: O34649 A0A6M3ZFQ9
Position
3134144..3134956
AA seq 270 aa
MRNSKETIDLLHEQYQFKQKKEKWKVHSFQLAIFILFFSGWEISSRQGWIDPLIFSSPSA
VWRLLLEKLGDGSLLSHIGVTLFETVLGFLLGTFMGTCLAALLWWSNRLARILDPYLVIL
NAMPKVALGPILIVALGPSFISIIAMGAIISVIITTIVVYTAFQEVDENYTKVMKTFGAK
KWVIFKEVILPASSPAIISTLKVNVGLSWVGVIVGEFLVSKVGLGYMIIYGFQVFNFTLV
FLSLLIIAIFATLMYQGVELLEKKWTKGRT
NT seq 813 nt   +upstreamnt  +downstreamnt
ttgagaaacagcaaagaaaccattgatctgcttcacgagcagtatcaattcaaacagaaa
aaggaaaagtggaaggtccattcctttcagcttgccatatttattctctttttctcgggc
tgggaaatctccagcaggcagggctggatcgatccgctgatcttcagctctccatcagct
gtgtggcgattattgctggagaaacttggtgacggttctttactgtcacacatcggcgtc
actttatttgaaacggtgcttggctttttgctcgggacgtttatgggcacgtgcctagcc
gctttgttatggtggtctaaccgacttgccagaattttagatccgtatcttgtgattttg
aacgcaatgccgaaagtggccctgggcccgatcctgattgtcgcgctcggtcccagtttt
atcagcatcattgcgatgggagccatcatcagcgtcattatcacaaccatcgttgtctac
accgccttccaagaggtcgacgaaaactatacgaaagtcatgaaaacattcggcgcaaaa
aagtgggttatttttaaagaagtcatactgcctgcatcctcccccgcgattatttcaaca
ctaaaagtgaacgtcggtttatcatgggttggcgttattgtaggggaattcctcgtttcg
aaggtcggattaggatatatgattatttacggattccaagtcttcaattttacactcgtc
ttcttaagcctgctgatcatcgccatcttcgccactctgatgtatcagggcgtcgagctg
ctggaaaagaaatggacgaaggggaggacataa

DBGET integrated database retrieval system