KEGG   Bacillus subtilis subsp. subtilis 168: BSU30630
Entry
BSU30630          CDS       T00010                                 

Gene name
ytkD
Definition
(RefSeq) 8-oxo-dGTP diphosphatase YtkD
  KO
K03574  8-oxo-dGTP diphosphatase [EC:3.6.1.55]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU30630 (ytkD)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.55  8-oxo-dGTP diphosphatase
     BSU30630 (ytkD)
DNA repair and recombination proteins [BR:bsu03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    BSU30630 (ytkD)
 Prokaryotic type
    BSU30630 (ytkD)
Motif
Pfam: NUDIX
Other DBs
NCBI-GeneID: 937072
NCBI-ProteinID: NP_390941
Pasteur: BG13869
BSORF: BG13869
UniProt: O35013 A0A6M4JLD3
Structure
PDB: 
4JZU 4JZS 4JZV 4JZT

Position
complement(3134983..3135459)
AA seq 158 aa
MYEFKDYYQNTVQLSFDDQPFSDSPKHVWVICRFGGKWLLTEHEDRGYEFPGGKVEPMEC
AEEAALREVKEETGARVKSLKYLGQYKVLGKEKVIVKNIYFADIEKLEKQADYFETKGPV
LFHELPENLSRNKKFSFIMKDSVLPISLKKLKESGWIE
NT seq 477 nt   +upstreamnt  +downstreamnt
atgtacgagtttaaagattattatcagaatactgttcagctttcctttgacgatcagcct
ttctcggacagcccgaagcatgtctgggtgatttgccgttttggcggcaaatggctttta
acagaacatgaggacagaggctatgagtttccaggcgggaaagtagagccgatggagtgc
gcagaagaggctgcgctccgggaagtaaaggaagagacgggcgcgagagtcaaaagcctc
aagtatctcggacagtataaagttctcggaaaagaaaaagtgattgtaaaaaatatatat
tttgcagatatagaaaagcttgaaaagcaggctgattactttgaaacgaaaggcccggtt
ttgtttcacgagctgccggagaacctttcccgcaataaaaaattcagctttattatgaag
gattccgttcttccgatcagcttgaaaaaactgaaagaatctggatggattgaataa

DBGET integrated database retrieval system