KEGG   Bacillus subtilis subsp. subtilis 168: BSU30659
Entry
BSU30659          CDS       T00010                                 

Symbol
ytzI
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Sid-5 FixS
Other DBs
NCBI-GeneID: 8302972
NCBI-ProteinID: YP_003097774
UniProt: C0H3Q1
Position
3136768..3136944
AA seq 58 aa
MLQLLKNGRWNVMTLLITISILIVLAVLLVTIWTTVKAYNVKHTIDPPQENHSDSHNQ
NT seq 177 nt   +upstreamnt  +downstreamnt
atgctacaattgttaaaaaacgggaggtggaatgtcatgacgcttctcattacgataagt
attttgattgtgctggctgttttgcttgtaaccatttggacgactgtaaaagcctataat
gtaaagcataccattgatccaccacaagaaaatcactctgattcacacaatcaatga

DBGET integrated database retrieval system