KEGG   Bacillus subtilis subsp. subtilis 168: BSU30660Help
Entry
BSU30660          CDS       T00010                                 

Gene name
ytkA
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YtkA Dala_Dala_lig_C
Motif
Other DBs
NCBI-GeneID: 937181
NCBI-ProteinID: NP_390944
Pasteur: BG11027
BSORF: BG11027
UniProt: P40768
Position
complement(3136938..3137375)
Genome map
AA seq 145 aa AA seqDB search
MKKMLVVLLFSALLLNGCGSGESKANTAETPEVLDVKLTGPEKVNPGESAAYEAAVSYGD
EAVTDADEVEFEVWKEGEKDASQMFKVKQEKGVYRLETTFKEDGVYTVQSHVTAKKQHSM
PTLKVQVGDADAASNQSEEEHSHHH
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatgttggttgttctgcttttttctgctttattgcttaatggatgcggatct
ggtgaaagtaaagcaaatacagctgagacgcccgaggttttggatgtcaagctgaccggg
cctgaaaaagtaaatcccggagaaagcgctgcttatgaagcagctgtatcatatggtgat
gaagctgtgacggatgccgatgaagtagagtttgaagtatggaaagaaggggaaaaagac
gcaagccaaatgtttaaggtgaaacaagaaaaaggcgtataccgattggaaacgacgttt
aaggaagatggtgtatacactgtccaatctcatgtcacagcaaaaaaacagcatagcatg
ccgaccttaaaagtccaagtcggagacgccgatgctgccagcaatcagtcagaagaggag
cattcacatcatcattga

DBGET integrated database retrieval system