KEGG   Bacillus subtilis subsp. subtilis 168: BSU30670
Entry
BSU30670          CDS       T00010                                 

Symbol
luxS
Name
(RefSeq) S-ribosylhomocysteine lyase
  KO
K07173  S-ribosylhomocysteine lyase [EC:4.4.1.21]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00270  Cysteine and methionine metabolism
bsu01100  Metabolic pathways
bsu01230  Biosynthesis of amino acids
bsu02024  Quorum sensing
Module
bsu_M00609  Cysteine biosynthesis, methionine => cysteine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BSU30670 (luxS)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSU30670 (luxS)
Enzymes [BR:bsu01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.21  S-ribosylhomocysteine lyase
     BSU30670 (luxS)
SSDB
Motif
Pfam: LuxS
Other DBs
NCBI-GeneID: 937106
NCBI-ProteinID: NP_390945
Pasteur: BG13866
BSORF: BG13866
UniProt: O34667 A0A6M3ZFB4
Structure
PDB: 

Position
complement(3137495..3137968)
AA seq 157 aa
MPSVESFELDHNAVVAPYVRHCGVHKVGTDGVVNKFDIRFCQPNKQAMKPDTIHTLEHLL
AFTIRSHAEKYDHFDIIDISPMGCQTGYYLVVSGEPTSAEIVDLLEDTMKEAVEITEIPA
ANEKQCGQAKLHDLEGAKRLMRFWLSQDKEELLKVFG
NT seq 474 nt   +upstreamnt  +downstreamnt
atgccttcagtagaaagttttgagcttgatcataatgcggttgttgctccatatgtaaga
cattgcggcgtgcataaagtgggaacagacggcgttgtaaataaatttgacattcgtttt
tgccagccaaataaacaggcgatgaagcctgacaccattcacacactcgagcatttgctc
gcgtttacgattcgttctcacgctgagaaatacgatcattttgatatcattgatatttct
ccaatgggctgccagacaggctattatctagttgtgagcggagagccgacatcagcggaa
atcgttgatctgcttgaagacacaatgaaggaagcggtagagattacagaaatacctgct
gcgaatgaaaagcagtgcggccaagcgaagcttcatgatctggaaggcgctaaacgttta
atgcgtttctggctttcacaggataaagaagaattgctaaaagtatttggctaa

DBGET integrated database retrieval system