KEGG   Bacillus subtilis subsp. subtilis 168: BSU30680
Entry
BSU30680          CDS       T00010                                 

Symbol
ytjA
Name
(RefSeq) membrane protein insertion efficiency factor
  KO
K08998  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU30680 (ytjA)
SSDB
Motif
Pfam: YidD
Other DBs
NCBI-GeneID: 937207
NCBI-ProteinID: NP_390946
Pasteur: BG13865
BSORF: BG13865
UniProt: O34601 A0A6M4JL66
Position
3138097..3138324
AA seq 75 aa
MKTLFIALIRGYQKFISPLTPPTCRFYPTCSQYGIEAIKTHGALKGGWLTIKRILKCHPF
HPGGVDPVPEKKQKH
NT seq 228 nt   +upstreamnt  +downstreamnt
atgaaaaccctattcatcgctctgatcagaggatatcaaaaattcatctcgcccctgaca
ccgccaacgtgccgcttttatccgacctgttcccaatatggaatcgaagcgattaaaaca
catggcgctttaaaaggcggatggctgacaatcaaacggattttgaaatgccacccgttc
catccgggaggagtcgatcccgttcctgaaaagaaacaaaaacattaa

DBGET integrated database retrieval system