KEGG   Bacillus subtilis subsp. subtilis 168: BSU30690
Entry
BSU30690          CDS       T00010                                 

Symbol
ytiB
Name
(RefSeq) carbonic anhydrase YtiB
  KO
K01673  carbonic anhydrase [EC:4.2.1.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00910  Nitrogen metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    BSU30690 (ytiB)
Enzymes [BR:bsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     BSU30690 (ytiB)
SSDB
Motif
Pfam: Pro_CA
Other DBs
NCBI-GeneID: 938087
NCBI-ProteinID: NP_390947
Pasteur: BG13863
BSORF: BG13863
UniProt: O34872 A0A6M4JNZ0
Position
complement(3138321..3138884)
AA seq 187 aa
MSLLNDILEFNKTFTEQREYEKYQTSKFPDKKMAILSCMDTRLVELLPHAMNLRNGDVKI
IKSAGALVTHPFGSIMRSILVAVYELNADEVCVIGHHDCGMSKISSKSMLEKIKARGIPE
ERIETIKYSGVDFDQWFKSFDSVEASVKDSVDVIKHHPLFPENVPVHGLVIDPKTGKLDL
IVNGYNN
NT seq 564 nt   +upstreamnt  +downstreamnt
atgagtcttctaaatgatattctcgaatttaacaagacatttactgaacaaagagagtat
gaaaagtatcaaacatcaaaatttccagataaaaaaatggcgattctttcttgcatggat
actcgtctggttgaactgctgccgcatgcgatgaatttgcgaaacggtgatgtgaaaatc
attaaaagtgccggtgcgcttgtgacacacccattcggaagcatcatgagaagtatactc
gtcgcagtgtacgagctgaatgcagatgaggtgtgtgtgatcgggcatcacgattgcggc
atgagcaaaatcagcagcaaaagcatgcttgaaaaaatcaaagcaagagggattccggaa
gaacgcatcgaaacaataaagtactccggtgtagactttgatcaatggtttaaaagcttt
gattcagtggaagcgagtgtgaaagacagcgtagatgttattaaacatcacccgctgttc
cctgaaaacgttccggtccatggcttagtcattgatcctaaaaccggaaaactggatctt
atcgtaaacggttataacaattaa

DBGET integrated database retrieval system