KEGG   Bacillus subtilis subsp. subtilis 168: BSU30700Help
Entry
BSU30700          CDS       T00010                                 

Gene name
rpmE2
Definition
(RefSeq) 50S ribosomal protein L31 type B
  KO
K02909  large subunit ribosomal protein L31
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU30700 (rpmE2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU30700 (rpmE2)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Bacteria
   Large subunit
    BSU30700 (rpmE2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L31
Motif
Other DBs
NCBI-GeneID: 937208
NCBI-ProteinID: NP_390948
Pasteur: BG13862
BSORF: BG13862
UniProt: O34967
Position
complement(3138978..3139226)
Genome map
AA seq 82 aa AA seqDB search
MKEGIHPKNHKVIFQDVNSGYRFLSTSTKTSNETAEWEDGNTYPVIKVEVSSDTHPFYTG
RQKFNEKGGRVEQFKKRYNMGK
NT seq 249 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaggaattcatccaaagaaccacaaagtgatatttcaggatgtcaacagcggc
taccgttttctaagcacctctacgaaaacatctaatgaaacagcagagtgggaggacgga
aacacatatcctgtcattaaagtagaggtaagctctgacacgcatccgttttatacaggc
cgccagaaattcaatgaaaaaggcggacgagttgagcagttcaaaaaacgctataacatg
gggaaataa

DBGET integrated database retrieval system