KEGG   Bacillus subtilis subsp. subtilis 168: BSU30720
Entry
BSU30720          CDS       T00010                                 

Symbol
ythB
Name
(RefSeq) cytochrome bd menaquinol oxidase subunit II
  KO
K00426  cytochrome bd ubiquinol oxidase subunit II [EC:7.1.1.7]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00190  Oxidative phosphorylation
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BSU30720 (ythB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU30720 (ythB)
Enzymes [BR:bsu01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)
     BSU30720 (ythB)
SSDB
Motif
Pfam: Cyt_bd_oxida_II Mu-like_gpT
Other DBs
NCBI-GeneID: 937206
NCBI-ProteinID: NP_390950
Pasteur: BG13858
BSORF: BG13858
UniProt: O34505 A0A6M4JLE4
Position
3140806..3141846
AA seq 346 aa
MEISTDALIAISIIWGFVFIYAVMATMDFGAGFWSMIYLNKEHMKATDIANRFLSPTWEV
TNVFIVAIVVALFSFFPGATFVLGTVLLIPGSMILLLLAIRSGFLVFSNTAKERKTLRYI
SGISGFIIPAILILVLPVTHGGFIEKTDGIYNLNMSKIFSSPNAYSFIGFAILSTLFLSS
LLLADFSNVAEEQDAYRAYRKSALITGPISLLFAVCIMVTMRNEANWLYSGMMNDFSWII
ASFITFVIAGIALFLPNKSFGQNIGKPRLALVAIGIQYFLASYAYGRAHLPYMIYPDVTV
MSGFTEPATFRALFATYIVAFIILFPGFFFFWKMFMRDKRYIRQEE
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggagatttcaactgacgctctgatcgccatctcaattatctggggctttgtgtttatt
tacgccgtcatggcgacaatggattttggagcgggattttggtctatgatctatttaaac
aaggagcatatgaaggccaccgatattgcgaatcgctttttgtccccgacttgggaggtc
acaaacgtctttattgtggccatcgtcgtggcgcttttcagttttttccccggcgcgaca
tttgtgctcggcaccgttttattaattcccggaagcatgattttgctgcttttagcaatt
cgaagcggatttctcgtgttttcaaatacagcaaaggagcggaaaacgctaagatatatt
tccggcatctccggctttatcattcctgctattttaattttggtgcttcctgtgacacac
ggagggtttatagaaaaaacggatggaatctataacttaaatatgtctaaaatcttttca
agccccaacgcctattcatttatcgggtttgcgattttaagcaccttatttttgtcctcg
ctgttgcttgcagatttttcaaatgtggcagaggaacaggatgcgtaccgagcctacaga
aaaagcgccctgattaccggcccgatttcactgttgtttgctgtatgcattatggtaact
atgcggaatgaagcaaactggctgtacagcggaatgatgaatgatttttcttggattatt
gcatcgttcattacatttgtcattgctggaatcgctctttttctgcctaacaaaagcttt
ggtcaaaacatcggaaaaccgcgtctcgcacttgttgcgattgggatacagtattttctc
gcaagctacgcgtacgggcgggcgcatcttccgtatatgatttatcccgatgtgacagtc
atgtcaggcttcacagagccagcaacgttcagagcgctgtttgcaacgtatatcgttgca
tttatcattctatttccgggcttctttttcttctggaaaatgtttatgcgagataaacgc
tatatccgccaggaggaatag

DBGET integrated database retrieval system