KEGG   Bacillus subtilis subsp. subtilis 168: BSU30739
Entry
BSU30739          CDS       T00010                                 

Symbol
ytzL
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF1540
Other DBs
NCBI-GeneID: 8303158
NCBI-ProteinID: YP_003097775
UniProt: C0H3Q2 A0A6M3ZG09
Position
3141900..3142058
AA seq 52 aa
MEQKILCEVNNCSYWGKGNKCTADAIYVVSHTGETAENSRETDCKTFKPHDL
NT seq 159 nt   +upstreamnt  +downstreamnt
atggagcagaaaattctatgtgaggtcaacaactgttcttattggggcaaaggtaacaaa
tgcaccgctgatgccatttatgttgtcagccatactggtgaaacggctgaaaacagccgg
gaaacagactgcaaaacgtttaagccgcatgatttataa

DBGET integrated database retrieval system