KEGG   Bacillus subtilis subsp. subtilis 168: BSU30740
Entry
BSU30740          CDS       T00010                                 

Symbol
mntD
Name
(RefSeq) manganese transport system membrane protein MntD
  KO
K11709  manganese/zinc/iron transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU30740 (mntD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU30740 (mntD)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Manganese/zinc/iron transporter
    BSU30740 (mntD)
SSDB
Motif
Pfam: ABC-3 FecCD
Other DBs
NCBI-GeneID: 937149
NCBI-ProteinID: NP_390952
Pasteur: BG13854
BSORF: BG13854
UniProt: O34500 A0A6M3ZFC5
Position
complement(3142077..3142964)
AA seq 295 aa
MSFEAWIIATGVLVGVSCGLIGTFLVLRSMAMLADAISHTVLLGIVGAFLVTGSLDGIYM
FIGAAATGLLTAFLVQLLHSKGVQSDAAIGVVFTSLFAIGVILLSVYGANVHLDIEHSLM
GEIAFVPWNTVTVFGVDIGPKAFWMLASVLVLNVVLISVCYKEFKIASFDPQMALALGIP
VLLIHYVQMGMLSLTTVASFDSVGAVLVVAMLIVPPAAAHLLTDRLLYMLILSALIGGLS
AVMGYFFATWLNVSISGAMAAMTGVCYASAFLFSPANGVITKKLRTLNMQKERAG
NT seq 888 nt   +upstreamnt  +downstreamnt
atgagttttgaagcatggattatagctaccggtgtattagtcggtgtaagctgcggattg
atcggcacatttcttgtgctgagaagcatggcgatgctggccgacgcaatcagtcacaca
gtgttgcttggcattgtcggcgcttttctagtgacgggaagtctcgatgggatttatatg
tttattggcgcagccgcaaccggtctgttaacggctttcttggttcagcttcttcatagc
aagggggttcaatcagatgctgccataggagttgtgtttacatccttatttgcaatcggg
gttattttgctttctgtgtatggagcgaatgtccatctcgatattgagcactcgttaatg
ggagaaatcgcttttgtgccgtggaatacggtgacggtattcggggttgatattgggccg
aaagcgttttggatgctggcatctgttctggttttaaacgtagtgttgatcagtgtgtgc
tataaggagtttaaaatcgcttcgtttgatcctcaaatggctttagccttgggaataccg
gttttgctcattcattacgtgcaaatgggcatgctgtccttgacgactgttgcttccttt
gattcggtgggtgccgtattggttgtggccatgctgattgttccgccggctgcggcacat
ttgctgacagaccggcttctttatatgctgattctcagcgcgttgattggcgggctgtcg
gcggtcatgggctatttcttcgcaacgtggcttaatgtttcgatttcaggagcgatggcg
gccatgacaggtgtatgttatgcaagcgcctttttgttttcacctgcaaacggggtcata
actaaaaagctgagaacactcaacatgcaaaaagaaagagctggctga

DBGET integrated database retrieval system