KEGG   Bacillus subtilis subsp. subtilis 168: BSU30750
Entry
BSU30750          CDS       T00010                                 

Symbol
mntC
Name
(RefSeq) manganese transport system membrane protein MntC
  KO
K11708  manganese/zinc/iron transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU30750 (mntC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU30750 (mntC)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Manganese/zinc/iron transporter
    BSU30750 (mntC)
SSDB
Motif
Pfam: ABC-3 FecCD Mrr_N
Other DBs
NCBI-GeneID: 937203
NCBI-ProteinID: NP_390953
Pasteur: BG13853
BSORF: BG13853
UniProt: O35024 A0A6M4JMN7
Position
complement(3142954..3144261)
AA seq 435 aa
MFESLWLQLQHPNTQWVLAGTLLLGTASGVLGSFVLLRKQSLIGDAMAHSALPGVCLAFL
FTGQKSLPFFLLGAALAGLLGTFCIQLIPRLSKTKEDSAIGIVLSVFFGVGIILLTYIQQ
QGAGSQSGLDSFLFGQAASLVRQDIILIAGISAVLLLLCIVFFKEFTLITFDLAFAKGLG
IPVRFLNGLLACLIVCAVVIGLQTVGVILMAAMLITPAITARYWTERLTGMIIIAGITGG
VSGVAGTLLSTTMKGMATGPLMILSATLLFLFSMICAPKRGLAAKAIRLMRLRRRTSREQ
VLLAIYEQYEKNNLCVTVESVRKKRRLSPSLCLKALNDLEQERCIERIENGIWQITSKGI
EKGYHTALKQRMYEVYLMHEMELANIESDQDYFDPDRLPRETRERLYSLLKLYGRMPERR
KASHDAEKGQIANEF
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgtttgaaagtttgtggctgcagcttcagcatccgaatacacagtgggtgctggccggt
acgcttttgctcgggacggcaagcggtgttttgggcagctttgtgctgctgagaaagcaa
agtttaatcggcgatgcgatggcccattcagctctgccgggagtgtgtctcgcttttctg
ttcaccgggcaaaaatcactgcctttctttttgctgggggcagcgctcgccggactgctc
ggaacgttttgtattcagctgattcctcggctttcaaaaacaaaggaggactcggcgatc
gggattgttctttctgtgttttttggcgtcgggatcattctgctgacatatattcagcaa
cagggggcgggaagccaaagcgggcttgattcttttttattcggccaggctgcttcattg
gtcaggcaggatatcatccttattgcagggatatccgctgttctactgctcctatgtatt
gttttctttaaggaatttacattgattacttttgatctcgcgtttgcaaagggattagga
atcccggtgcgttttttaaacgggcttttggcttgtctgattgtctgtgctgtcgtcatt
gggcttcagactgttggtgtgatattaatggcggctatgctgattacacctgccataacc
gcgagatattggaccgaacgattaaccgggatgatcatcattgccgggattacaggcggg
gtcagcggagtggccggaaccctgcttagcaccacgatgaagggaatggcgacagggcca
ttaatgatcttatctgcaacgctgctctttcttttttcaatgatttgcgcgcctaagcgg
ggattggctgctaaagccataaggctgatgaggctgcggcgcagaacaagcagggagcaa
gtgcttttggcgatttatgaacagtatgaaaagaataatctttgtgtaactgttgaaagt
gtaagaaagaaaagacgcctatccccttcattatgccttaaggcattaaatgacttggaa
caagagaggtgcattgagcgtatcgaaaatgggatttggcaaatcacaagcaaagggata
gaaaaaggctatcacacagctttgaagcagcggatgtatgaagtgtatctcatgcatgaa
atggaacttgccaatatagaatccgatcaggactactttgacccggaccgtttaccgaga
gaaacgagagagcggctttattcactcttaaagctgtatggacggatgcctgagcgtcga
aaagcgtctcatgatgccgagaagggacagatcgcaaatgagttttga

DBGET integrated database retrieval system