KEGG   Bacillus subtilis subsp. subtilis 168: BSU30770
Entry
BSU30770          CDS       T00010                                 

Gene name
mntA
Definition
(RefSeq) manganese-binding lipoprotein MntA
  KO
K11707  manganese/zinc/iron transport system substrate-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU30770 (mntA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU30770 (mntA)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Manganese/zinc/iron transporter
    BSU30770 (mntA)
Motif
Pfam: ZnuA Ribosomal_L32e PrpR_N
Other DBs
NCBI-GeneID: 937219
NCBI-ProteinID: NP_390955
Pasteur: BG13851
BSORF: BG13851
UniProt: O34385 A0A6M3ZFC3
Position
complement(3145038..3145958)
AA seq 306 aa
MRQGLMAAVLFATFALTGCGTDSAGKSADQQLQVTATTSQIADAAENIGGKHVKVTSLMG
PGVDPHLYKASQGDTKKLMSADVVLYSGLHLEGKMEDVLQKIGEQKQSAAVAEAIPKNKL
IPAGEGKTFDPHVWFSIPLWIYAVDEIEAQFSKAMPQHADAFRKNAKEYKEDLQYLDKWS
RKEIAHIPEKSRVLVTAHDAFAYFGNEYGFKVKGLQGLSTDSDYGLRDVQELVDLLTEKQ
IKAVFVESSVSEKSINAVVEGAKEKGHTVTIGGQLYSDAMGEKGTKEGTYEGMFRHNINT
ITKALK
NT seq 921 nt   +upstreamnt  +downstreamnt
atgagacaagggctgatggcagcagtactttttgcgacctttgctttaacgggatgcgga
acggattcagccggaaaaagcgctgatcagcaattacaagtgacagcgacaacatctcaa
attgccgatgcagcagaaaacatcggaggtaagcacgtaaaagtcacctctttaatggga
ccgggggttgatccgcacctttacaaagcttcccaaggtgacacgaaaaaattaatgtct
gccgatgttgttctgtacagcgggttgcatttggaagggaaaatggaggatgtcctccaa
aaaatcggcgaacaaaaacaatcggcggcagtagctgaggccattccgaaaaataagctt
attcccgcgggggaaggcaagacgtttgatccccacgtctggttcagcattccgttatgg
atctatgcggtggatgaaattgaagcgcaattcagcaaagcaatgcctcagcacgcagat
gcctttcggaaaaatgccaaagagtacaaagaagatttgcaatatttagataagtggtcg
cgtaaggagatcgcacatattccggagaaaagccgtgtgcttgtgactgctcatgatgcg
tttgcgtactttgggaatgagtatggatttaaggtaaaaggcctgcagggactcagcaca
gattcggactatggattaagggatgttcaggagctggttgatcttctgacagaaaaacaa
ataaaagctgtgttcgtagaaagcagtgtatctgaaaaatcaatcaatgcagtggtggaa
ggcgctaaagaaaaaggccatacagtcacaatcggcggtcagctttattcggatgccatg
ggtgaaaagggcacaaaagaaggcacatacgaaggaatgttccgccacaatatcaacacg
attactaaagcgcttaaataa

DBGET integrated database retrieval system