KEGG   Bacillus subtilis subsp. subtilis 168: BSU30780
Entry
BSU30780          CDS       T00010                                 

Gene name
menC
Definition
(RefSeq) o-succinylbenzoate synthase
  KO
K02549  o-succinylbenzoate synthase [EC:4.2.1.113]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00130  Ubiquinone and other terpenoid-quinone biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    BSU30780 (menC)
Enzymes [BR:bsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.113  o-succinylbenzoate synthase
     BSU30780 (menC)
SSDB
Motif
Pfam: MR_MLE_C MR_MLE_N MAAL_C Enolase_C
Other DBs
NCBI-GeneID: 937201
NCBI-ProteinID: NP_390956
Pasteur: BG13847
BSORF: BG13847
UniProt: O34514 A0A6M3ZFL1
Position
complement(3146238..3147353)
AA seq 371 aa
MIEIEKITLYHLSMNLKKPFKNSIETLQERKFLIVEAIDTSGVTGWGEVSAFSSPWYTEE
TIGTCLHMLKDFFIPNVVGREFNHPSEVPDSLARYKGNRMAKAGLESAVWDIYAKKKGVS
LAEALGGTRDKVPAGVVVGLAPLDDMLKEIESYQKEGYQRIKIKIQPGQDVELVKAIRSR
FPTIPLMADANSSYELKDISRLKELDDYHLMMIEQPLQADDIVDHRHLQKHLKTAICLDE
SICSVDDARRAIELGSCKIINIKPSRVGGLTEALKIHDLCKEHHMQVWCGGMLETGISRA
QNVALASLPQFTIPGDISSSSRYWDEDIVTPDIRIDNGFISVSKQPGLGVEVNQDIMRKY
VTKMDVFTQHG
NT seq 1116 nt   +upstreamnt  +downstreamnt
atgatcgaaatagaaaaaatcacgctttaccatttgagcatgaacttaaagaaaccgttt
aaaaacagtatcgaaacgcttcaagagcgtaaatttctgatcgtggaagccattgataca
tcaggtgtcacaggctggggagaagtttccgctttctcttcgccttggtacaccgaggaa
accattggaacatgtttgcatatgctaaaagatttttttatcccaaatgtcgtcggccgt
gaattcaatcacccttcagaagtgccggacagcctggcgcggtataaaggaaaccggatg
gcaaaagcgggacttgaatcggctgtatgggatatttatgccaaaaagaagggcgtatcc
cttgctgaggcattgggcggaacaagagataaagtccctgccggggtggtagtcggcctg
gcgcctcttgacgatatgctgaaggaaattgagagctatcaaaaagaaggttatcaaaga
ataaaaattaaaattcagcctgggcaggatgtggaattggtcaaggccatccgcagccga
ttcccaaccatcccgcttatggccgatgccaattcctcttacgaactgaaggatatcagc
cgtttaaaggagcttgatgactatcatttaatgatgattgagcagccgctccaagctgac
gatatcgttgaccaccgccacttgcagaaacatttgaaaacggccatttgccttgatgag
agcatttgttcagttgatgatgcgagacgggcgattgagctaggaagctgcaaaattatt
aatataaaaccttctcgtgtcggcggcttaacagaagccttaaaaattcatgatttatgc
aaagagcatcatatgcaggtttggtgcggaggaatgctggaaacaggcatatcaagagcg
cagaacgtggcgcttgcttcactgcctcaattcacaatacctggcgatatatcttcatcc
tcacgctattgggatgaagatattgtaactcctgatattcgtattgataatggatttatt
tctgtgtcaaaacagcctggtttaggggttgaggtaaaccaagatattatgcgaaaatat
gtgaccaaaatggatgttttcacacagcatggttaa

DBGET integrated database retrieval system