KEGG   Bacillus subtilis subsp. subtilis 168: BSU30790Help
Entry
BSU30790          CDS       T00010                                 

Gene name
menE
Definition
(RefSeq) 2-succinylbenzoate-CoA ligase
  KO
K01911  O-succinylbenzoic acid---CoA ligase [EC:6.2.1.26]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00130  Ubiquinone and other terpenoid-quinone biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    BSU30790 (menE)
Enzymes [BR:bsu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.26  o-succinylbenzoate---CoA ligase
     BSU30790 (menE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 937132
NCBI-ProteinID: NP_390957
Pasteur: BG10687
BSORF: BG10687
UniProt: P23971
Structure
PDB: 

Position
complement(3147350..3148810)
Genome map
AA seq 486 aa AA seqDB search
MLTEQPNWLMQRAQLTPERIALIYEDQTVTFAELFAASKRMAEQLAAHSVRKGDTAAILL
QNRAEMVYAVHACFLLGVKAVLLNTKLSTHERLFQLEDSGSGFLLTDSSFEKKEYEHIVQ
TIDVDELMKEAAEEIEIEAYMQMDATATLMYTSGTTGKPKGVQQTFGNHYFSAVSSALNL
GITEQDRWLIALPLFHISGLSALFKSVIYGMTVVLHQRFSVSDVLHSINRHEVTMISAVQ
TMLASLLEETNRCPESIRCILLGGGPAPLPLLEECREKGFPVFQSYGMTETCSQIVTLSP
EFSMEKLGSAGKPLFSCEIKIERDGQVCEPYEHGEIMVKGPNVMKSYFNRESANEASFQN
GWLKTGDLGYLDNEGFLYVLDRRSDLIISGGENIYPAEVESVLLSHPAVAEAGVSGAEDK
KWGKVPHAYLVLHKPVSAGELTDYCKERLAKYKIPAKFFVLDRLPRNASNKLLRNQLKDA
RKGELL
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgctgacagaacagcccaactggctcatgcagcgggcacagctgacacctgagagaatc
gctctcatctatgaagaccaaaccgtgacatttgcagaattgtttgccgcgtctaaacga
atggcggaacagcttgccgctcattcggttcggaaaggggatactgcagctattttgctc
caaaaccgtgcagaaatggtatacgctgttcacgcttgttttttgcttggtgttaaggcg
gtgcttttgaatacgaagctgtcaacacatgaaaggctgtttcagctggaggattcggga
tccggctttttattgacagattcaagctttgagaagaaagaatatgaacacatcgttcaa
acgattgatgtggatgaactgatgaaagaagcagcagaggaaattgagatcgaggcttat
atgcaaatggatgcaacggcaacgctgatgtatacgtcgggtacgacaggaaagcccaag
ggagttcagcaaacgttcggaaaccattatttcagtgcggtgtcgtccgctcttaatttg
ggtataacagaacaagaccgctggcttatcgcattgccgctctttcatatcagcggattg
tccgcattatttaaatctgtgatctatggaatgactgtcgtgcttcaccagcgtttttcc
gtaagcgatgtgctgcattctatcaacaggcatgaagtgacaatgatatctgcggtgcag
actatgctggccagtcttttggaagaaacaaaccgctgccctgaatccatcagatgcatt
cttctcggcggcggtcctgcaccgctgccattgcttgaggaatgccgtgagaaaggattc
cctgtctttcagtcatatggaatgacagaaacatgctcgcaaattgttaccctgtcgccg
gaattcagcatggaaaagctcggatctgcggggaaaccgctgttttcgtgtgaaatcaaa
atagagcgggacggacaggtatgtgaaccgtatgaacacggtgaaatcatggtcaaaggc
ccgaatgtcatgaaaagctattttaaccgggagagcgcaaacgaagcctcctttcaaaat
ggctggctgaaaacaggtgatcttggttatttggacaatgaaggctttttatatgtatta
gacagacgttcagatctgatcatatccggcggagaaaacatttatccggccgaagtggag
tcagtgctgctttcacaccccgctgtggccgaagccggggtttcaggggctgaggacaaa
aaatgggggaaagtgcctcacgcctatcttgtccttcacaagcctgtgagcgcaggagaa
ttgactgactactgcaaagaacgcttggcgaagtataaaattccggcaaaattctttgtg
cttgaccgcctgccgcgcaatgcgtctaataagctcttgcgaaatcagctgaaggatgcg
cgtaaaggagaactgctatga

DBGET integrated database retrieval system